(data stored in ACNUC9435 zone)

EMBL: CP000904.PE174

CP000904.PE174       Location/Qualifiers
FT   CDS_pept        complement(262208..263032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5631"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46598"
FT                   /db_xref="GOA:A9VUM7"
FT                   /db_xref="InterPro:IPR036716"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM7"
FT                   /protein_id="ABY46598.1"
FT                   /translation="MNDTMCPETSTCSSCSPEPYSWEWVAVEATGGVISGVAGFAAVAL
FT                   IKHLFIKEEADQTRDLFKEAVEQICNYINKAIDEAFIREYLADTDNVKEQLKYFAGSNG
FT                   NNIKLIEDIQSEASRLVQRFYRLGDIAIGALELACSLHLVILKTLATHNPDNWKVPFET
FT                   STKEYAEMLSHNANEFLNNVKSRITPPEFGMLPDGGIPPTKLTLGCQFNVDDEPLSFGY
FT                   GTVTISDDQAIERAREQCNQRHKEKYDEIVNPGILVYNKIMAVSTDLKNIQF"
     atgaatgata caatgtgtcc agaaacttca acatgttctt catgttctcc agaaccatat        60
     tcttgggaat gggtagcagt agaagctaca ggtggtgtga taagtggagt cgcaggattc       120
     gctgcagtag ctttaataaa acaccttttt attaaggaag aagctgacca aactcgtgat       180
     ttgtttaaag aagcagtaga acaaatttgt aactacatta acaaagctat cgatgaggct       240
     tttatcagag aatatttggc cgataccgat aatgttaaag aacaattaaa atacttcgca       300
     ggttcaaacg gaaacaacat aaaattaatc gaagatattc aatcagaggc ttcgaggcta       360
     gtacaacgtt tttacagact aggggatata gccatcggcg cactagaact tgcttgtagt       420
     ttacatctag ttattctaaa aacattggct actcataatc ctgataactg gaaagtacca       480
     tttgaaacat caactaaaga atatgcagaa atgcttagtc ataatgccaa tgaatttttg       540
     aataacgtca agtctagaat aacaccacct gaattcggta tgcttcctga cggtggaatt       600
     ccacccacaa aacttaccct tggatgtcaa ttcaatgttg atgatgaacc gttatcgttt       660
     ggttacggta cggtgacgat ttccgatgat caagccattg agagagcacg agaacaatgt       720
     aatcaacgtc ataaagagaa atatgatgaa atcgttaacc caggtattct tgtttacaac       780
     aaaattatgg cagtaagtac ggatttgaaa aatattcaat tttaa                       825
//

If you have problems or comments...

PBIL Back to PBIL home page