(data stored in ACNUC9435 zone)

EMBL: CP000904.PE175

CP000904.PE175       Location/Qualifiers
FT   CDS_pept        complement(263503..264936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5632"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   baa:BXA0056 IS231-related, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5632"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46599"
FT                   /db_xref="GOA:A9VUM8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM8"
FT                   /protein_id="ABY46599.1"
FT                   /translation="MTLSIQDEFHLFAEELQRYLSPNILQQLAQETGFVKRKSKYGARD
FT                   LDALCIWISQHVASDSLTRLCSQLYANTATLMSPEGLNQRFNRCAVLFLQRIFSLLVKS
FT                   QLNDSSQIKNQYTSYFQRIRILDATIFQVPNHLAPIYPGSGGCAQTAGIKIQLEYDLHS
FT                   GKFLNFQMEPGKNNDKTFVTDCLDTLSPGDLCIRDLGYFSLKDLDQMDQRGVFYVSRLK
FT                   LNNRVYVKNDSPEFFRDGTVKKQSLYVLLNLEDIMHQIKPGDTYEIRNAYIGQQKLPSR
FT                   VVIYRLTSTQTHKRRKQQTYVEKKKGVTYSEKSKRLTEINVYITNIPWEIVPMEQVHNI
FT                   YSLRWQIEIVFKTWKSLFGINHCHNIKRERLECHLYGQLIAIFLCSSTMFKMRQLLLQK
FT                   KQKELSEYKAIYIIQDHLYLVYEAIQKDTQEVSKIFLCLFDFLQKNGRKSHRYEKKTVF
FT                   DILGVVYQFTVSNLKQKTA"
     atgactctat cgattcaaga tgagtttcat ttattcgctg aagaactaca gcgatatcta        60
     tctccaaaca tccttcaaca gctcgcacag gagacgggtt tcgtaaaacg taaaagtaag       120
     tatggcgcac gagatttgga cgctttatgt atttggatta gtcaacacgt agcaagtgat       180
     tccctcactc gattatgtag tcaactttat gcaaatacag ctacacttat gagtccagaa       240
     ggacttaatc aacgttttaa ccgatgcgct gttttatttc tacagcgtat attttctctt       300
     ttagtcaaaa gtcaactaaa tgattcgtct caaatcaaaa accaatatac ttcttatttt       360
     caacgtatac gtattttaga tgctactatt tttcaagtcc ctaatcattt ggctcctatt       420
     tatcctggtt caggaggatg tgcacaaaca gctggtatca aaattcagct agagtatgat       480
     ttacatagtg gaaaattcct taattttcaa atggagccag gtaaaaataa tgataaaacc       540
     tttgttacag attgtttaga taccttaagc ccaggagatt tatgtattcg agatttagga       600
     tacttttctc taaaagattt agaccagatg gatcaacgcg gtgtattcta tgtttcacgg       660
     ttgaaattaa ataatagagt atatgtaaaa aatgattctc cagaattctt tcgggatggg       720
     acagtaaaaa agcaatctct atatgtttta cttaaccttg aagatattat gcatcagata       780
     aaaccaggag atacttatga aattcggaat gcctatattg gacaacaaaa attaccctca       840
     cgagttgtaa tatacagact gacatcaact caaactcata aacgtaggaa acagcaaacc       900
     tatgttgaaa agaaaaaagg agttacatac tctgaaaaaa gtaaacgatt aacagaaatc       960
     aacgtttata ttaccaacat accatgggaa attgttccga tggaacaggt tcataatatc      1020
     tactcactac gttggcaaat agagattgta tttaaaacat ggaaatctct ttttggtatt      1080
     aatcattgtc acaatattaa gcgagagcgt ctagaatgtc atctttatgg acagttaatc      1140
     gctatttttc tttgttcttc cactatgttc aaaatgcgac agctgttact acagaaaaaa      1200
     caaaaagaat taagtgaata taaagcaatt tatataattc aagatcatct gtacttagta      1260
     tatgaagcta tacaaaaaga cacccaagaa gtatcaaaaa ttttcctttg tctatttgac      1320
     ttcttacaga aaaacggacg gaaatcccat cgatatgaga aaaagacagt ctttgatatt      1380
     ttaggtgtcg tttatcagtt tactgtatcc aatctaaagc agaaaactgc ataa            1434
//

If you have problems or comments...

PBIL Back to PBIL home page