(data stored in ACNUC9435 zone)

EMBL: CP000904.PE176

CP000904.PE176       Location/Qualifiers
FT   CDS_pept        complement(265011..265394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5633"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46600"
FT                   /db_xref="GOA:A9VUM9"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUM9"
FT                   /protein_id="ABY46600.1"
FT                   /translation="MIQMKKKATLFFFLNIVIIGMLIFNLFVFTTRMPFLPWFIEDGWG
FT                   YLGLVLTSFVLLIISLKSYQLYKNGEITILQISIPLVSAMFSLFVMFMPLNDFMTIFSL
FT                   IVDVSILIISLISFRGTVTSLSN"
     gtgattcaaa tgaagaaaaa agcaaccctt ttcttttttt taaatatcgt aataattggt        60
     atgttaatat ttaatttatt tgttttcaca acacgaatgc cctttttacc ttggtttatt       120
     gaagatggtt ggggatattt aggactagta ctgacatctt ttgttttatt aatcatctct       180
     ttaaaatctt atcagcttta caaaaatgga gagataacta ttttacagat ttctatcccg       240
     cttgtttctg caatgttttc actctttgtt atgtttatgc ccttaaatga ttttatgact       300
     atattttctc ttatagtcga tgtaagtata ttaataattt ctttaatatc ttttaggggt       360
     accgtcacat cgctatcaaa ctaa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page