(data stored in ACNUC9435 zone)

EMBL: CP000904.PE177

CP000904.PE177       Location/Qualifiers
FT   CDS_pept        complement(265485..265943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5634"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: dsy:DSY0300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5634"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46601"
FT                   /db_xref="GOA:A9VUN0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN0"
FT                   /protein_id="ABY46601.1"
FT                   /translation="MDKQEFIQLVNKKLKLIRIENDLSQDKMSEVIGLSKKTLVEIEKG
FT                   RRSLTWTGAVCVVTLFEDSDIIQMTFGDDINEIIKTIAFTHYNNSSSKTLGGKLWWRQI
FT                   RELNGYKIQQNILSQHYRILNKENHRICSSFELDEIEKRFIEVTKSLQ"
     atggataaac aagaatttat tcaattagta aataaaaaat taaaactcat ccgtattgaa        60
     aatgatttat cacaagataa aatgtctgaa gttatcggtt tatcaaaaaa aaccttagta       120
     gaaatagaaa aaggtagacg tagtctcaca tggacaggcg cagtgtgtgt tgtcactctt       180
     tttgaagata gcgatataat ccagatgact tttggagacg atattaacga gattatcaaa       240
     acaattgctt ttacacatta taataatagt tcctcaaaaa ctttaggagg aaaactatgg       300
     tggagacaaa taagagagtt aaatggttat aaaatacaac aaaatattct ttctcaacat       360
     tatcgaattt taaataaaga aaaccatagg atatgtagtt catttgaatt agatgaaatt       420
     gaaaaaagat ttatagaagt aacaaaatca ttacaatag                              459
//

If you have problems or comments...

PBIL Back to PBIL home page