(data stored in ACNUC9435 zone)

EMBL: CP000904.PE178

CP000904.PE178       Location/Qualifiers
FT   CDS_pept        complement(266142..266510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5635"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46602"
FT                   /db_xref="GOA:A9VUN1"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN1"
FT                   /protein_id="ABY46602.1"
FT                   /translation="MIQMKKKSNHYLFINNVIIGMLILNLFIFTSSIRFLPWFIEDGWG
FT                   TLGLLLTSFVLLITFFKSYQLHKNGERTILQTSIPLVSAMFSFFVMLTLSDFMTIFSLI
FT                   VNVSILIICLISFGKNSN"
     gtgattcaaa tgaagaaaaa aagcaaccat tatcttttta taaataacgt aataattggt        60
     atgttaatat taaatttatt tattttcaca tcatcaatac gctttttacc ttggttcatt       120
     gaagatggtt ggggaacttt aggtctatta ctgacatctt ttgttttatt aatcaccttt       180
     tttaaatctt atcagcttca caaaaatgga gagagaacta ttttacagac ttctatcccg       240
     cttgtttctg caatgttttc attctttgtt atgttaacct taagtgattt tatgactata       300
     ttttctctta tagtcaatgt aagtatatta ataatttgtt taatatcttt tgggaaaaat       360
     tctaattaa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page