(data stored in ACNUC9435 zone)

EMBL: CP000904.PE179

CP000904.PE179       Location/Qualifiers
FT   CDS_pept        complement(267692..270076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5637"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase family 51; penicillin-binding
FT                   protein transpeptidase; KEGG: bcy:Bcer98_1722
FT                   penicillin-binding protein, 1A family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5637"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46603"
FT                   /db_xref="GOA:A9VUN2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN2"
FT                   /protein_id="ABY46603.1"
FT                   /translation="MSENYLSRTERKQVHKNEKPNTKKNKKQTSFFRKLLIGCLVLGTL
FT                   GLIGVATTFFTLIKDAPILEKSKLVNPLSAKIYDKDGKLIYEYGKEKRTNITYNQLPKL
FT                   IENAFLATEDARFYDHSGVDFKGTARAVLVSLTGNYGSQGGSTITQQVIKNYFLSTEKT
FT                   AKRKVQEIYLAHKLEKRYSKHQILEMYLNKIYLGNRSYGIRTAAQNYYGKELKDLTLPQ
FT                   VAMLAGLPKGPSIYDPTKQQNIEKATERRNVVLSAMYQNKYISEEQMTEASRVSVKEGL
FT                   MPPKEVNEMPYPVFIDAVVKEVEKELPDAHIESDGLSIYTTLDPKAQKFAENILNTNII
FT                   SYPNDNFQGAFTFMDTKTGEVRAIGSGRGENKATFKGENMAIELKRSIGSTMKPIFDYG
FT                   PAIEYLKWPTSHQLDDSNYKYSTGQKVQNADRTYKGMMTMRDALKMSRNIPAIKTAKEV
FT                   GISKAQGFAEGLGIKFGKEVPESTAIGTNEGSPTEIAGAYAAFGNDGKYTKPHFVKKVV
FT                   YPDGESKSFEPKSKRVMEDYTAYIVTDMLRSVVTSGTGTAANVDSLDVAGKTGTTNYSA
FT                   ADVAKYGIPSSASRDSWFAGYTPQYTMAVWTGYMKNGPEDYISSKNTKIAQQIFKEMMH
FT                   KFGTNKSKFKMPKTVIQDNSELRVKGAKQESSPNVNTNTVIQMETGEKDQKQEQNEQDK
FT                   NQQEQKQGEQDKNQQEQKQSEQDKNQQEQKQSGQDKNQQEQKQSGQDKNQQEQKQGEQD
FT                   KNQQEQKQSEQDKNQQEQKQGEQDKNQQEQKQGEQDKNQQD"
     atgtcagaaa attatctatc tagaacagaa cgaaaacaag ttcacaaaaa cgagaaacca        60
     aacactaaaa aaaacaaaaa acaaacgtcg ttttttcgca aattattaat tggatgttta       120
     gtacttggaa ccctaggcct tataggggtg gcaactactt tttttacatt aataaaagat       180
     gccccaatac ttgaaaaatc aaagctggta aatccactat cggcaaaaat ctatgataaa       240
     gatggaaaat tgatatatga atatgggaag gaaaaacgaa caaatattac atacaatcaa       300
     ttacctaaat tgatagagaa tgcattttta gcaacagagg atgcacgatt ttatgatcat       360
     agtggtgttg acttcaaggg gactgcacgt gcagttttag tcagccttac aggtaattac       420
     ggctcgcaag gcggtagtac aattacgcag caggtgatta aaaactattt cttgtccaca       480
     gaaaaaacag ctaagcgtaa ggtacaagag atatatttag ctcataagtt agaaaaacga       540
     tattcaaaac atcaaatatt agaaatgtac ttaaataaaa tttatctagg aaaccgttca       600
     tatggtatta gaacagcagc tcagaactat tacggaaaag agttaaaaga tttaacttta       660
     ccgcaagttg cgatgcttgc ggggttacca aaaggaccta gtatctatga tccaacaaaa       720
     caacaaaata tagaaaaggc aacagaacgt agaaatgtag tactatcggc aatgtaccaa       780
     aataaatata tttctgagga acaaatgaca gaagcatcta gggtatctgt gaaagaagga       840
     ctgatgcctc ctaaagaagt aaacgaaatg ccgtatcctg tatttataga tgctgttgtg       900
     aaagaagtag agaaagaatt gccagatgca catatcgagt cagatggctt atctatttac       960
     acaacattag acccaaaagc acagaagttt gctgaaaata ttttaaacac aaatattatt      1020
     agttatccaa atgataactt ccaaggtgct tttacattta tggatacaaa gacaggtgaa      1080
     gttcgtgcca taggtagcgg gcgtggtgaa aataaagcga cttttaaagg ggagaatatg      1140
     gctatcgaac taaagcgttc cataggttca acaatgaagc caatatttga ttatggtcca      1200
     gcgattgaat atttaaaatg gccaacctcc catcaactag atgattcgaa ttataaatat      1260
     tcaacagggc agaaggttca aaatgctgat agaacgtata agggtatgat gacaatgcgt      1320
     gatgctctta aaatgtctcg caacataccg gcaattaaaa ctgcaaaaga agtagggatt      1380
     agcaaagctc aaggcttcgc agaaggttta ggtattaaat tcggaaaaga ggtacctgaa      1440
     tcaacagcga ttggtacgaa tgaaggatca ccaaccgaaa ttgcaggagc atatgctgca      1500
     tttggtaatg atggtaaata tacaaaacca cattttgtta aaaaagtggt ttaccctgat      1560
     ggggaatcaa aaagttttga gccgaaatct aagcgtgtga tggaagacta cacagcatat      1620
     atagtaactg atatgttgcg ctctgtcgtt acctcaggta ctggtacagc agcaaatgta      1680
     gattctttag atgttgcagg taaaacagga acgacaaact attcagctgc agacgtagcg      1740
     aaatatggta taccatctag tgcatcacgt gatagttggt tcgctggtta tacaccacaa      1800
     tatacaatgg cggtgtggac tggatatatg aaaaatggcc ctgaagatta tataagtagt      1860
     aaaaatacga aaattgcaca acagattttc aaagaaatga tgcataagtt tggcacaaat      1920
     aaatctaagt ttaaaatgcc gaaaactgta atccaagaca atagcgaatt gcgtgtgaag      1980
     ggcgccaagc aagaatcttc tcctaatgtg aatacaaaca cagttataca gatggagact      2040
     ggtgaaaaag atcaaaagca ggaacaaaat gaacaagata agaatcaaca agagcaaaaa      2100
     caaggtgaac aagataagaa tcaacaagag caaaaacaaa gtgaacaaga taagaatcaa      2160
     caagagcaaa aacaaagtgg acaagataag aatcaacaag agcaaaaaca aagtggacaa      2220
     gataagaatc aacaagagca aaaacaaggt gaacaagata agaatcaaca agagcaaaaa      2280
     caaagtgaac aagataagaa tcaacaagag caaaaacaag gtgaacaaga taaaaatcaa      2340
     caagagcaaa aacagggtga acaagataag aatcaacaag actaa                      2385
//

If you have problems or comments...

PBIL Back to PBIL home page