(data stored in ACNUC9435 zone)

EMBL: CP000904.PE18

CP000904.PE18        Location/Qualifiers
FT   CDS_pept        36595..38649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5450"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46442"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV10"
FT                   /protein_id="ABY46442.1"
FT                   /translation="MSINIRQKRFTVAVNQILQEELRKGNLPTSKEFASRLNKLLRDQE
FT                   LGAPEYKFKLIRNGELAESDFFNEVVGKIQKDLMILYENTIAVHNQLKGKFHWFEVEKN
FT                   RLEYEARRLESELKEKILLYGKTGYLASIFDTFDDLSKIDSEDNVSIDIKNHQITLKKQ
FT                   ENTSFLINPASEIKFVMPKSSVSTFKKIPISGKIEQALNANTNETFQEVWLSKTEGPAD
FT                   GYIDIKFNDKQVLNRIDLSLHTIKSATVYIEFSLDELNYFHLPYYPDGKQTGNNVSFYF
FT                   PTTEMKNMRIWIRKQESDKEIVHPEGYSYQYLFGVKKIQFFQLSYPERGEVVTKFLTPK
FT                   TDETFSIGKVSLVTEEEIPDGTDIEYFVRVDDREESWKQISPVNRDTAQAPNLIDFKYV
FT                   VHASPTNLGIRKNIGGQESEIIELQANGVAFYSLGSIEKRKIVPRTERLYMGKDAWSVQ
FT                   KTVENFGETHIPSLDDWKKPSNDIVRNVIPIQEGHRGLILQDEQFTQHTQLYYGMGIFY
FT                   EGKEQVLSTIPSSTEPIAIFLNGEKLFEGIPSSQTNVNYKFKQGWNDLTVLVYVQNLNK
FT                   DCTIDLGFDPIRVSTHCYSSSQFLEKVSVFDLRYNTKNNDWSKYALYEKDGKVYIVVNH
FT                   SLPGVTYDFYYDYVDEVEHRNIQLKIAMKQFSVGQYTTPVLRRYTLQFS"
     atgtctatca atattcgtca aaaacgtttt accgtagcgg taaaccaaat ccttcaagaa        60
     gaactgagaa agggaaatct tcctacatcc aaggagttcg cttctcgttt aaataaacta       120
     ttaagagatc aagaattagg tgctcctgag tataaattta agcttattcg taatggtgaa       180
     ttagctgagt ccgatttttt caatgaagtt gttggaaaaa ttcaaaaaga tttgatgatt       240
     ctttacgaaa atacaattgc tgttcataac cagctaaagg gaaagtttca ttggtttgaa       300
     gtagaaaaga atcgattaga gtatgaagct agaagattag aatcggaatt aaaagagaaa       360
     attttgctat atgggaagac aggttactta gctagtatct ttgatacatt tgatgaccta       420
     tctaaaattg attcagaaga caatgtatct atcgatataa agaatcatca aatcaccctt       480
     aaaaaacagg agaatacctc atttttaatt aatcctgcta gtgaaattaa gttcgttatg       540
     ccaaaaagtt ctgtaagtac atttaagaag attcccattt cagggaagat tgaacaagca       600
     ttaaatgcaa atacaaatga aacattccaa gaagtatggt tgtctaaaac ggaagggcca       660
     gctgatggat atatagatat caaatttaat gataaacagg tattgaatcg aattgattta       720
     agcctacata caattaaaag tgctactgtg tatattgaat tctcgctaga tgaactgaat       780
     tatttccact taccatatta tccagatggt aaacagacag ggaataacgt atctttttat       840
     ttcccgacaa cagaaatgaa gaatatgcga atttggattc gcaaacagga aagtgataaa       900
     gaaattgtcc atcctgaagg ttattcatat cagtacttgt ttggagttaa aaaaattcaa       960
     tttttccaat taagttatcc agaaagagga gaggttgtta caaaatttct tacgccaaaa      1020
     acagatgaga cattctctat tggaaaagta tcattggtta cagaagaaga gattccggac      1080
     ggtacggata tcgagtactt tgtacgagta gatgacaggg aagagagctg gaaacagatt      1140
     tctcctgtta acagggatac tgcacaagca cctaacctaa ttgattttaa atatgttgtt      1200
     catgctagtc caacaaactt gggcattcga aagaatatcg gtggccaaga atctgagatt      1260
     atcgaactgc aagcaaatgg agtcgcattc tactcattag gttctattga gaaacgtaaa      1320
     atcgttccgc gaacagagcg tttgtatatg gggaaagatg cttggagtgt tcagaagaca      1380
     gtagagaatt ttggggaaac ccatatccct tctctcgatg attggaagaa gccatcaaat      1440
     gatatcgttc gaaatgtaat accaatccag gaagggcatc gaggactgat tctacaagat      1500
     gaacaattca cacaacatac gcaactgtat tatggaatgg gtattttcta tgaaggaaaa      1560
     gaacaagtgc tttctacaat cccatcatct acagaaccga ttgccatctt cttaaatgga      1620
     gaaaagttat ttgaaggaat cccttcttct caaactaatg taaactacaa atttaaacag      1680
     ggatggaatg atctaactgt gttggtgtat gtacagaatt tgaataagga ctgtacgatt      1740
     gatttaggat ttgatccgat tcgtgtaagt actcattgtt attcttcaag tcagttcctg      1800
     gaaaaggtat ctgtattcga cttacgatat aacacaaaga acaacgattg gtctaagtac      1860
     gccctttatg agaaagatgg aaaggtttat attgtggtta atcattcact accgggtgta      1920
     acatatgatt tttactatga ctatgtggat gaagtagagc accgaaatat tcaattgaaa      1980
     atcgctatga aacaattctc agtagggcag tatacaacac ctgtattacg tcgatataca      2040
     ttacaattta gttag                                                       2055
//

If you have problems or comments...

PBIL Back to PBIL home page