(data stored in ACNUC9435 zone)

EMBL: CP000904.PE180

CP000904.PE180       Location/Qualifiers
FT   CDS_pept        complement(271598..272314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5638"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Tetracyclin repressor
FT                   domain protein; KEGG: lla:L154512 transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5638"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46604"
FT                   /db_xref="GOA:A9VUN3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR003012"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN3"
FT                   /protein_id="ABY46604.1"
FT                   /translation="MKWRIPMKKQQPQISEDKILEASWELLGEEGIEKLSMRRLADRLG
FT                   IQAPSLYWYFKSKQNLYQRLANQVSKIILEEFHSEGDWKEQLSELAVTVRSVLSRYPCS
FT                   TQIMMMTLPHEPDIIRFTNRMLLCVESTPLEQEQKMQVVTTLVNYVYYFVLDDYQHQRN
FT                   VSAILKVNETLPGEEMIPGEEMIRLLDSMNETDAGLFRRMFTNGLFELMGTDRAFEFGL
FT                   NLILLGVEQVIKEQVE"
     atgaaatgga ggataccaat gaaaaaacag cagcctcaga tttcggagga taagatttta        60
     gaagcctcat gggagcttct tggagaggag ggtattgaga aactcagtat gagaagattg       120
     gcagacaggc ttgggattca ggctccctct ttgtattggt acttcaagag caaacaaaat       180
     ctctaccagc gtctagccaa ccaggtatct aaaataattt tggaggaatt ccactccgaa       240
     ggggattgga aggaacagtt gtctgagctt gcggtaacgg taagaagtgt gctcagccgc       300
     tatccatgct ctacgcaaat tatgatgatg acactgcccc acgaaccaga tatcatccga       360
     ttcaccaacc ggatgctgct atgcgtggaa tcaacaccgc ttgagcaaga gcagaaaatg       420
     caagtggtta ctacacttgt taactatgtc tactacttcg ttctagacga ttatcaacat       480
     caacgtaatg tctccgctat ccttaaggtc aatgaaacgc ttccaggaga agaaatgatt       540
     ccaggagaag aaatgattcg ccttctagac tctatgaatg agacggatgc gggactgttc       600
     cggaggatgt tcacgaacgg actgtttgag ctgatgggta ctgacagagc gtttgaattt       660
     ggtttgaatt tgattttgct cggggtcgag caggtgatta aggaacaggt ggagtaa          717
//

If you have problems or comments...

PBIL Back to PBIL home page