(data stored in ACNUC9435 zone)

EMBL: CP000904.PE181

CP000904.PE181       Location/Qualifiers
FT   CDS_pept        272427..273779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5639"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: ssp:SSP2140
FT                   putative Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5639"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46605"
FT                   /db_xref="GOA:A9VUN4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN4"
FT                   /protein_id="ABY46605.1"
FT                   /translation="MDAENLYYFEKASVSKAVAHFAVPMMLGTSMSVIYSILNAYFLGT
FT                   LHSTAMLTALALTLPLFAIIMALGNLIGMGSGTFISRLLGEKKYDDVKHVSSFAFYSSL
FT                   VLGLIAIAVGLPLIDQIVYGLGATSDSFEFTKDYVTIMIIGSPFVILFFTLENIVRSEG
FT                   AAITSMIGMILSVVVNIILDSLVIFVFHWGVTGVASATVISSVVASAFYAFHIRYKSQF
FT                   LTVSAKWFKVTKEILSNVFKIGVPVFIMSIFLGAMSLILNHFLIEYGDQAVAAYGISSR
FT                   LLQFPEFILMGLCEGIVPLIAFSFTANKMRMKHTIGFTIKTIVALAFVFGVIVYLISDN
FT                   LIGLFTNDPHLIEMGSYILHVTFLSLFITGMTALFTGIFQATAQGTAAFIMSIIQGITL
FT                   IPVLFIANHMYGFHGVIWSLVIADAVSFLVGAIMLYVLRNKLQPDLDSLVQ"
     atggatgcag aaaacctcta ttactttgaa aaagcatcgg tcagtaaagc tgttgcccat        60
     ttcgctgtac caatgatgct aggcacgtca atgagtgtca tatattcaat cttgaatgcc       120
     tatttccttg gtacgctcca cagtactgcc atgttaaccg cactcgcatt aaccttgccg       180
     ttatttgcaa tcattatggc gctaggaaat ttgattggca tggggagtgg tacattcatc       240
     tcacgtttgc taggagagaa aaaatatgat gatgtaaagc atgtgtcttc attcgccttt       300
     tacagcagct tagttctcgg tcttatcgcg atagctgtcg gcctcccatt gattgatcaa       360
     atcgtttatg gccttggggc aacgtctgac tccttcgaat ttacaaagga ctatgtcaca       420
     attatgatca taggctcacc atttgtcata ttgttcttca cactggagaa tatcgtgcgc       480
     tcagaaggtg cagcaatcac gtctatgatt ggtatgattc tcagcgttgt cgtgaatatt       540
     attctagatt cactagtcat tttcgtcttc cattggggcg taactggggt tgcttccgct       600
     acggtaattt cgagcgttgt tgccagtgca ttttacgctt ttcatataag atataaaagc       660
     caattcttaa ccgtttcagc aaaatggttc aaggttacta aagagattct gagtaatgta       720
     tttaaaatcg gagttcccgt ctttattatg agtatctttt tgggtgcaat gtcgctcatc       780
     ttaaaccact ttcttataga atatggggat caggcagtag ctgcttacgg gatatcatca       840
     cgtttattgc aatttcctga gtttatcctg atgggcttat gtgagggaat agtgccgctt       900
     atcgcctttt cttttacagc caataaaatg cgcatgaagc atacaatcgg atttacaatt       960
     aaaacgatag tggcgttagc cttcgtattc ggcgttatcg tttatctgat atctgataac      1020
     ttaattggtt tatttacgaa tgacccacat ttaattgaaa tgggaagtta cattctgcat      1080
     gtaacgttct tatccttgtt tattaccgga atgaccgcgt tgtttacggg tatatttcaa      1140
     gcaacagcac aaggaactgc tgcgtttatt atgtcaatta ttcaaggaat tacactaatt      1200
     cctgtgttgt ttatcgccaa tcatatgtac ggattccacg gagtaatctg gtcgcttgtc      1260
     attgcagatg ccgtctcatt ccttgtgggt gctatcatgc tgtatgtttt acggaacaaa      1320
     ttgcagccgg atttggatag tttagtacag tag                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page