(data stored in ACNUC9435 zone)

EMBL: CP000904.PE182

CP000904.PE182       Location/Qualifiers
FT   CDS_pept        274389..274583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5640"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   lme:LEUM_1982 predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5640"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46606"
FT                   /db_xref="GOA:A9VUN5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN5"
FT                   /protein_id="ABY46606.1"
FT                   /translation="MKNIIRILRKEKKLSQEDLAKLCHVSRQTINAIENNKYDPTLELA
FT                   FNLAKSLGVTVDQLFIYKI"
     atgaagaaca taattcgtat tttacgtaaa gagaaaaagc tttcccaaga agatttagct        60
     aaattatgtc atgtttcaag acaaacgatt aatgcgattg agaataacaa atatgatcct       120
     acattggaac ttgcttttaa tttagctaaa tcccttggtg taacggttga tcaattattt       180
     atttataaaa tctag                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page