(data stored in ACNUC9435 zone)

EMBL: CP000904.PE183

CP000904.PE183       Location/Qualifiers
FT   CDS_pept        274649..274987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5641"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46607"
FT                   /db_xref="GOA:A9VUN6"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN6"
FT                   /protein_id="ABY46607.1"
FT                   /translation="MGLLAFEWYEKQQISITSLFVATIILQSLFMKRILKGKKESENFI
FT                   DEMFLHIRQKSLSICCFVMYVLTLGTLFLSEGTWNFSHMHNKPLIFLVFLYPIVYQISH
FT                   IFVSRNNS"
     atgggtttac ttgcttttga atggtatgag aaacaacaga tttctataac ctcgttattt        60
     gtagcaacaa tcattttgca atcattattt atgaagagaa ttttgaaagg taaaaaagag       120
     agcgagaatt ttattgatga aatgttttta catatcagac agaaaagctt atcaatttgt       180
     tgttttgtaa tgtatgtatt aactttaggt actttatttt tatcagaagg aacatggaat       240
     tttagccata tgcataataa accgttaatc tttctggttt tcttatatcc tatagtttac       300
     caaataagtc atatattcgt ttcaagaaac aactcttaa                              339
//

If you have problems or comments...

PBIL Back to PBIL home page