(data stored in ACNUC9435 zone)

EMBL: CP000904.PE184

CP000904.PE184       Location/Qualifiers
FT   CDS_pept        275505..276251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5642"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46608"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN7"
FT                   /protein_id="ABY46608.1"
FT                   /translation="MHYYPPFLLVFWFSKPFIHCLSAYNPFLTLPFRMQKVTWLQDLGV
FT                   CQQIKARRHGKIAPSVYILTLHTNYLKIVEYFKIKWTVAIDICSTFISFLTNKHSKKNI
FT                   QTSSSVDLFSLEEQLKPNTDIQSKEDKNRLQDLNDYLSDDQKKAYYYILSQELTYLSEN
FT                   DAYIIALRLPPDIDRYTRWDIEECVQWFQFNTAEISNPAHFIKMFNQKSKQNQERRKRH
FT                   TKKTNSFLGANNNRKFIFFNFLEENS"
     ttgcattatt atcccccttt cctacttgtc ttttggttct ccaaaccatt catacattgc        60
     ctgtcggctt ataatccatt ccttacgctt cccttcagga tgcaaaaagt aacatggctg       120
     caagatttgg gtgtatgtca gcagattaaa gcacgaagac atggtaagat tgccccttcc       180
     gtttacattt taaccttaca tactaattat ttaaaaatcg tcgaatactt caagataaag       240
     tggactgtag caattgatat ctgctctact tttattagct ttttaacaaa caagcatagt       300
     aaaaagaata tacaaacttc atcttctgta gaccttttca gtttagaaga gcaactcaaa       360
     cccaatacgg atattcaatc aaaagaagat aaaaacagat tgcaagactt aaacgattac       420
     ttaagtgatg atcagaaaaa agcatattat tacattttga gtcaagaatt aacatacctt       480
     tccgaaaatg atgcgtacat aattgcttta agactgccac ctgatatcga tcgctacaca       540
     agatgggata ttgaagaatg tgtgcaatgg tttcagttta atacagctga aatcagcaat       600
     cctgcgcatt tcataaagat gtttaatcaa aaatctaaac agaatcaaga acgtagaaaa       660
     cgtcatacca aaaaaacaaa ctcgtttttg ggtgcaaata ataatcgtaa gtttattttc       720
     tttaactttt tagaagagaa cagctaa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page