(data stored in ACNUC9435 zone)

EMBL: CP000904.PE185

CP000904.PE185       Location/Qualifiers
FT   CDS_pept        complement(277903..279594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5644"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0226 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5644"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46609"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUN8"
FT                   /protein_id="ABY46609.1"
FT                   /translation="MAKPFVIKNKRSLNGETTTPVLVTIKAWQKLVEALEGKYYSFKDT
FT                   YLEDIVNSMSYEERIADEEGFVEKAKPSFSLQMKNLFTKANGRKHKLYGITNADLEVFL
FT                   FLHKKCNTYGELSHVSIHMLWEDYKNYKEVFAHIHHSQFYVALKKLSLHNIIEIENEYS
FT                   GKYKITLTDFMNKETNKANPYTFISPIVFTKEFFDLSIAAKKLFIDIAMQQKRETTLKR
FT                   SLYKFDEQGQQTHFGGIYRFLHKKYPHQIRSVMAELTTKSTATGSSLFKICKLEKGKKN
FT                   KKQYTTLHLSVHPDFLCNKEIGEEYRDPFTPRLTYKRKAKFIEESLVEMNIAEFTKDIN
FT                   QFVNVLKHSCHRQIRQVIRGLREMIDRQEGFPKNLVYTLSKLLKQSSQYRVLDTAAKTG
FT                   IYSLITHNVPREKQEDAVFKFGTHFAIYSLQNVKKLFCKAHDLLHATYAVPVTEEAYHR
FT                   NYMQYQEETLFRKYAFEQGVNVNAYIALEIKIRELLKSHGHKEHHIPSDIRELFIEKID
FT                   RLPKEKIRVIEVPKDFNLIDFLHSLEAYYRKNSETPCTVDQLLPAM"
     atggctaaac ctttcgttat aaagaacaaa cgtagtttaa atggtgaaac aacaactcca        60
     gtattagtaa caattaaagc atggcaaaaa ttagtggaag ctttagaagg caaatactat       120
     agctttaaag atacatatct agaagatatc gtaaattcaa tgtcttacga ggaacgaatt       180
     gcagatgaag aagggtttgt tgaaaaagcc aaaccatctt tttcacttca aatgaaaaat       240
     ctcttcacta aagcaaatgg tagaaagcat aagctatatg gtattactaa tgcagatcta       300
     gaagtatttc tatttctaca taaaaaatgt aatacctatg gtgaactttc tcatgtttcc       360
     attcacatgc tttgggagga ctacaaaaac tataaagaag tatttgcaca tattcatcat       420
     tcgcaattct atgttgcgtt gaaaaagctt agcttacaca acatcattga aattgagaat       480
     gaatacagtg gtaaatataa aattacatta actgatttta tgaacaagga aacgaataaa       540
     gcgaatcctt acacgtttat cagcccaatt gtatttacaa aagagttctt cgatttatcc       600
     attgctgcta aaaagctatt tattgatatt gcaatgcagc aaaaacgaga aactactttg       660
     aaacgttcac tatacaaatt tgatgaacaa ggacaacaga ctcattttgg cggtatatat       720
     cgcttcttac ataagaaata cccacatcag atacgttctg taatggctga attaacaact       780
     aaatcaactg ctactggatc ttctttgttt aaaatttgca aattagaaaa agggaaaaag       840
     aataaaaagc agtatacaac actgcattta tctgtacacc ctgatttcct gtgtaataag       900
     gaaatagggg aagagtatcg cgatccattt acaccaagac ttacatataa acgtaaagct       960
     aagttcattg aagaatcatt agttgaaatg aatattgcag aatttacaaa agatataaac      1020
     caatttgtaa atgtcttaaa acattcctgt catcgtcaaa tccgtcaagt gattcgtgga      1080
     ttacgtgaaa tgattgatag acaagagggt ttccctaaaa atcttgttta tacactaagc      1140
     aaattattaa agcagtcttc tcaatatcgc gtattagata cggctgctaa aacaggtatt      1200
     tattctctga ttacacataa tgtgccgaga gagaaacaag aagatgcggt atttaaattt      1260
     ggtactcact tcgctatata ttcattacaa aatgttaaga agttattctg taaagcgcat      1320
     gaccttcttc atgctacata tgcggttcct gtgactgaag aagcatacca tcgtaattat      1380
     atgcagtatc aagaagaaac actatttagg aagtatgctt ttgagcaagg agtaaatgtt      1440
     aacgcatata ttgcattaga aattaaaatt cgtgaattat taaaatctca tggccataaa      1500
     gaacatcata ttccaagtga tattcgcgaa ctgttcattg aaaaaataga tagattgcct      1560
     aaggaaaaaa tccgcgtaat tgaagttcct aaagacttta atttaatcga ttttcttcat      1620
     tccttagaag cttattaccg taaaaatagt gaaacaccat gcacggtaga tcagctgctt      1680
     cctgcaatgt aa                                                          1692
//

If you have problems or comments...

PBIL Back to PBIL home page