(data stored in ACNUC9435 zone)

EMBL: CP000904.PE187

CP000904.PE187       Location/Qualifiers
FT   CDS_pept        283310..283993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5646"
FT                   /product="regulatory protein GntR HTH"
FT                   /note="PFAM: regulatory protein GntR HTH; fatty acid
FT                   responsive transcription factor FadR domain protein; KEGG:
FT                   ilo:IL1821 negative regulator for fad regulon"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5646"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46611"
FT                   /db_xref="GOA:A9VUP0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR014178"
FT                   /db_xref="InterPro:IPR028374"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP0"
FT                   /protein_id="ABY46611.1"
FT                   /translation="MKEKERSSDKIENELIRSILAGVYSVGSTLPPERELAKEFGVGRP
FT                   TIREALQRLERSGWITGRKGMPAIINDYWSNGNLTTLINIVENHHTITDEFIMYLLEFR
FT                   SSLTPTYIRDAVTFNQPKVVALLANLEQLEDSAESYAAFDWYLQKRCAGLAANPIFLLI
FT                   LNSFDSIYVDMAKRYFSVKDHRGLSFNYYHDLLKAALKGDAIEAERLCKTTLEKSLALW
FT                   KDRKK"
     ttgaaagaaa aggaacgctc ctcagataaa attgagaatg aattaattag atccatattg        60
     gctggtgttt attctgtagg aagtacttta ccgccggaaa gagagcttgc gaaagaattt       120
     ggtgttggtc gcccaactat tcgggaggcg cttcaacgtt tagaaaggag tggatggata       180
     acaggaagaa aaggaatgcc agcgattatt aatgattatt ggagcaatgg gaatctaacg       240
     acacttatta atattgttga gaatcatcat accattacag atgaatttat tatgtattta       300
     ttagaattta gaagttcgtt gactccgact tatattcgtg atgctgttac gtttaatcaa       360
     cctaaagtgg ttgctctcct tgctaatctt gagcaacttg aagatagtgc agaaagctat       420
     gcagcatttg attggtattt gcaaaaaagg tgtgctgggc ttgctgccaa tccgatcttt       480
     ctactcattt taaatagctt cgattccatt tatgtagata tggcgaaaag atatttttct       540
     gtaaaagatc atcgtgggtt gtccttcaac tattatcacg acttattaaa agctgcatta       600
     aagggagatg caattgaagc ggaaagattg tgtaagacaa cattggagaa aagcttggct       660
     ctctggaaag atagaaaaaa ataa                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page