(data stored in ACNUC9435 zone)

EMBL: CP000904.PE189

CP000904.PE189       Location/Qualifiers
FT   CDS_pept        285907..286323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5648"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5648"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46613"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP2"
FT                   /protein_id="ABY46613.1"
FT                   /translation="MNEVLSEKYKVIKFPAEVVNMFADILEEDEILYNVFHYIGSEVNK
FT                   QYQETKYMRGISINEIVGNVVIDRRVKKLKGKSYSLEVERTNISRRSAEVSVSTLSSMS
FT                   LITEKIMHPYKFLISTIRGQQVLIELGKRKETNR"
     ttgaacgagg tattgagcga aaagtataaa gtaattaaat ttcctgctga agttgtgaac        60
     atgtttgcag acattcttga agaggacgaa atactttata atgtatttca ttacatagga       120
     tctgaggtaa ataaacaata ccaagagacg aaatatatga gaggcatctc aataaatgaa       180
     atagtaggta atgttgtaat tgataggaga gttaagaaat taaagggaaa atcatactca       240
     ttagaggttg aacgaaccaa tatatcaaga agatcagctg aagtaagtgt tagtacatta       300
     tcttcaatgt cattaataac tgaaaaaatt atgcaccctt ataaattttt aatctcaaca       360
     attagagggc agcaggtgtt aattgaactt ggaaaacgta aagaaacgaa tagataa          417
//

If you have problems or comments...

PBIL Back to PBIL home page