(data stored in ACNUC9435 zone)

EMBL: CP000904.PE19

CP000904.PE19        Location/Qualifiers
FT   CDS_pept        38828..39601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5451"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46443"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV11"
FT                   /protein_id="ABY46443.1"
FT                   /translation="MQIEKKYKPSFHKANARYRGVTELSQYTNFVLESAHDLLLLGNIT
FT                   EGNEATHKDGHKKEMYNNFISIMTGDREVGKSSLFTASTLQKIDYSRTVPIPELDSWSP
FT                   LNGCTKTAVSDAIKLSSNGLLDPVGMFSTLYVEPGDKLYIRMKVRSTGGASDFSFGSNN
FT                   MRMGPDKNGDTRKVPLAKSNEFITLDYVLRFQYAESVSININVHEKPNELKAENVEIKD
FT                   LEIYYFNETPIQASSIDMVIKPNVDELEEKINSIR"
     atgcaaatag aaaagaaata taaaccttct ttccataaag ccaatgctcg ttaccgtggt        60
     gttactgagc tttcccaata tacgaatttt gttcttgaat ctgcccacga ccttttatta       120
     ttaggaaaca ttacagaagg aaatgaagca acacataaag atggacacaa aaaagaaatg       180
     tacaataatt tcatttctat catgacaggt gatcgggaag tagggaagtc gagtttattt       240
     acggcttcca cacttcaaaa aattgattac tcacgaacag ttcctattcc tgaattagat       300
     agttggagtc ctttaaatgg ctgtacaaaa acagcagtga gtgacgcaat taagctctct       360
     tcaaatggat tgctagatcc agtaggaatg tttagtactc tttatgtaga accaggagac       420
     aagctttata ttcgaatgaa ggtaagaagt acaggtggtg cttcagactt ttcctttggt       480
     tcgaacaata tgcgtatggg accagataag aatggtgaca caaggaaggt tcctttagcg       540
     aaaagtaatg aatttatcac tctcgattac gtgttacgtt tccaatatgc tgaatcagta       600
     tcaattaata taaacgttca tgaaaaaccg aacgagttaa aggcggaaaa tgttgaaata       660
     aaagatcttg agatatatta ctttaatgaa acaccaattc aagcttcatc tatcgacatg       720
     gttattaaac caaatgttga tgaactagaa gaaaaaatta attcgatacg atag             774
//

If you have problems or comments...

PBIL Back to PBIL home page