(data stored in ACNUC9435 zone)

EMBL: CP000904.PE190

CP000904.PE190       Location/Qualifiers
FT   CDS_pept        286344..287798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5649"
FT                   /product="putative FtsZ/tubulin-related protein"
FT                   /note="KEGG: bcz:pE33L466_0217 possible
FT                   FtsZ/tubulin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5649"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46614"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP3"
FT                   /protein_id="ABY46614.1"
FT                   /translation="MAKNFLKNEVAVKMTMVGFGQAGTRMVDKFAEYKHTDGTSVYNCL
FT                   ALNSNDGDLAELKNVPKSNQVSLKLGGLGKNPERAVKVLESNDEAKAKLKEFITERVRP
FT                   TDELVLFFAGLGGGTGTSTIIKAIEEFSAFHNKPIIAEELKSMAMKISREELIANQQKY
FT                   ARIAFNNAIERKDFIKMGIVVTLPVRADGPDVLRQVNKFSQEIWKLANEPAKGVAFVVF
FT                   ADNQHFYDEFKGLNENEKKGIANSRDYANQRIGEIIHELNTASNGAGTSVILDSQDFKR
FT                   ILLEKTGCLVINKISRNMNQIENSKEIVDMFSESLKGSSFHPPIELMKKNDDGELEASK
FT                   VHHFGMLAILDEQKNIDDSFMDDAKVEVTNTLPINGTVFNGYLISKNDFMGSVYTFYKT
FT                   DALPSRLSKGLVEEFNEFKEKQNQIQFKKSQISTIEMQDQDDDFSINFGDYIDMGTSNE
FT                   EPSADAENDEELAAFMDPDKMFGTSK"
     atggcgaaga actttctgaa aaacgaagta gcagtaaaaa tgacaatggt tggttttggt        60
     caagccggaa ctagaatggt agataaattt gctgaatata agcatacgga tggaacatct       120
     gtgtacaact gtcttgcttt aaatagtaac gatggtgatt tagccgaatt aaaaaatgtg       180
     cctaaaagta accaagtatc actaaaatta ggcggactag gaaagaatcc agaacgtgct       240
     gtaaaagtac tagaatcaaa tgatgaagcg aaagcaaagt taaaagaatt catcacagag       300
     cgtgtaagac caacagatga attggtacta ttttttgctg gattaggcgg tggaacaggt       360
     acttctacaa tcattaaagc aattgaagaa ttctcggctt ttcataataa acctataatc       420
     gctgaagaac ttaaaagtat ggcaatgaaa atttctagag aggaattaat agcaaatcaa       480
     caaaagtatg caagaattgc attcaataat gcaattgagc gtaaagattt tattaaaatg       540
     ggtattgttg tgacactccc tgtaagagcc gatgggcctg atgtactaag acaagtaaat       600
     aaattctctc aagagatttg gaagttagca aatgaaccag caaaaggtgt tgcattcgtt       660
     gttttcgcgg ataaccaaca tttctatgat gaatttaagg gattaaacga aaatgagaaa       720
     aaaggtattg ctaattcacg agactatgct aatcagcgca ttggtgaaat catccatgaa       780
     ttaaatacag cttctaatgg cgcaggaaca tctgttattt tagattctca ggactttaaa       840
     cgtattttat tagagaaaac tggctgtcta gttattaata aaatttctcg caatatgaat       900
     caaattgaaa atagtaaaga aatagtagat atgttctcag aatcgttgaa aggaagctct       960
     ttccaccctc ctatagaatt aatgaaaaag aacgatgatg gtgagttgga ggcttctaag      1020
     gtgcatcatt ttggaatgct tgcaattcta gacgaacaaa agaatatcga tgattcattt      1080
     atggatgatg caaaagtaga agttacgaat acattaccaa tcaacggtac ggtatttaat      1140
     gggtatttaa ttagtaaaaa tgattttatg ggcagtgtgt atacgttcta taaaactgat      1200
     gcattaccgt cccgtttgtc taaaggttta gttgaagaat tcaatgaatt taaagagaag      1260
     caaaatcaaa ttcagtttaa aaaatctcaa attagtacaa ttgaaatgca agatcaagac      1320
     gatgatttca gtattaattt tggtgattac atcgatatgg gaactagtaa tgaggaacca      1380
     tcagcagatg ctgagaatga tgaagaatta gctgcattta tggatccaga caaaatgttt      1440
     ggtacatcaa aataa                                                       1455
//

If you have problems or comments...

PBIL Back to PBIL home page