(data stored in ACNUC9435 zone)

EMBL: CP000904.PE191

CP000904.PE191       Location/Qualifiers
FT   CDS_pept        complement(287834..288571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5650"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="KEGG: bcz:pE33L466_0216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5650"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46615"
FT                   /db_xref="GOA:A9VUP4"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010332"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP4"
FT                   /protein_id="ABY46615.1"
FT                   /translation="MIKQENQSEQTMVDDENSLHEDAFEKAWRITEFSKLVGRHHNTVY
FT                   NWFNTLEEKGLHGTLRTNNTNEKLYNSLDLNIALFIKQKRDEKWSLDAIIELLPHQFEL
FT                   RPVSPENHSNEVLSQIDFQDAAETIEKLVEQKVQAHLQNIEIQFQEKFENVLKALPQPE
FT                   DPIAMKERQRQERLDNIIIEHRARKELRRQAEKLWNEKPEEERVKKVGWFKKEEDLAKK
FT                   HLFIENYLNENMIEYMQSIMTSE"
     atgattaagc aggaaaatca atcagaacaa accatggtag atgatgagaa ctcattacac        60
     gaagacgctt ttgaaaaagc ctggcgaata acagagtttt ctaagttagt aggtagacac       120
     cataatactg tttataattg gttcaatacg ttagaagaga agggattgca cgggacactt       180
     agaaccaata atacaaatga aaagctatat aattcattgg atttaaatat agctcttttc       240
     ataaaacaga aaagggatga aaagtggtct ttagatgcca taatcgaact tttgccgcat       300
     caatttgaac taaggccagt atctcctgaa aaccactcta atgaagtatt atctcaaatt       360
     gattttcaag acgcagctga gacaattgaa aaattggtgg aacaaaaagt tcaagcacat       420
     ttacaaaaca tcgaaataca attccaagag aaatttgaaa atgtattaaa agcattgcct       480
     caacctgaag atccaattgc tatgaaagaa cgtcaaagac aagagagact tgataacata       540
     ataattgaac atagagctcg taaagagtta agaagacaag ctgaaaaact ctggaatgaa       600
     aagcctgagg aagagcgtgt gaaaaaagtt ggttggttta aaaaagagga agatctagca       660
     aaaaaacacc tttttataga gaattattta aacgaaaata tgatagagta tatgcaatct       720
     attatgacat cagaataa                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page