(data stored in ACNUC9435 zone)

EMBL: CP000904.PE192

CP000904.PE192       Location/Qualifiers
FT   CDS_pept        290656..293061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5651"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: btk:BT9727_2889 sensory transduction histidine
FT                   kinase; sporulation kinase A; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; PAS fold-3 domain protein; PAS
FT                   fold-4 domain protein; PAS fold domain protein; SMART: PAS
FT                   domain containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5651"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46616"
FT                   /db_xref="GOA:A9VUP5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP5"
FT                   /protein_id="ABY46616.1"
FT                   /translation="MIIKDYFINLSIFSLLVSAAIFIQVFTIHSRRYFEKFYGGIIAVT
FT                   LMFFSFPYMGFSYDLRAVPLILSFIYFGRIAGWITLISIIIMRIFYIGGYWEPPVMAYF
FT                   GMGILFTIFKTYFKSLHPFKSAPLYFSVFVGMKWLVGVFFITTVLYTPGLVFIALGLLI
FT                   GVFLMEAYQRLYYLTQDLSKMNQKLKKSKQELKDTVHELQGGIFKFKKTDKHFIHTLCD
FT                   GQFYYQNGIYSERVVGKSLRTIDASIIPPHLVPQLMKYYLQAWEGKEIIFELPWPNDKT
FT                   IILIALRPIKRNGQVIEVVGSTVDITERKKVESELRATKELLESFIKHNVDAITISDRE
FT                   GHILQANKAYEKIFGWSSHEIIGKRLPCVPDFLMDESLGNIQKILTGESVVTRLETVRQ
FT                   RNDGSLLDVSLTVSPILDVRGNVIALSAICRDISERKQAERERQRLHQQLRDSEMKYRA
FT                   LIEQATDAVYVVELNEDQFPSRFIEVNPVGCNRFGYSREELLSMPFPNNVPQDSPIIIQ
FT                   LLEKIREGQTSFTLQDEHIFPTGKTITTEFSVRIFNLNGKKVFLSISRDITERLKTEEL
FT                   LRKSEKLAVVGQLATAIAHEINNPLTAMKGFMQLLKSTENENNQGYINIVSSEIERIES
FT                   ITNEFMAVAKPQVVRIQPNDISVLTDQVLLILQPQAMMNNIQIRTDYTPGIPLIPCEGN
FT                   QLKQVFVNILKNAIESMPMGGEILIQIDKLDNDQISIRFIDQGCGIPKERIPYLGEPFY
FT                   SIKEEGIGLGLMICYKIIETHQGKVFIESEVNKGTTVEVTLPICTIQK"
     atgataatta aagactattt catcaatctt tctatttttt ctttattagt tagcgcagca        60
     atatttattc aagtgtttac gattcattcc aggcgatatt ttgaaaaatt ctatggaggg       120
     atcatcgcag ttactttgat gttcttttcg tttccgtaca tgggattttc ctacgatctc       180
     cgggctgttc ctcttattct ttcttttatt tactttggtc gcattgctgg ttggattaca       240
     ttaattagca ttattataat gcgcatcttt tacattggtg ggtattggga accacctgtg       300
     atggcttatt tcggtatggg tattctattt actattttta aaacttattt caaaagcctt       360
     catccattta aaagtgcacc tctatacttt tctgtttttg tgggtatgaa gtggttagta       420
     ggtgtattct ttattactac agtgctttat actccaggct tagtatttat agctttagga       480
     cttttaatcg gtgtttttct tatggaagct taccaaagat tatattactt aacacaggac       540
     ttatctaaaa tgaatcaaaa attaaaaaaa tcgaagcaag aactcaaaga taccgtacat       600
     gagcttcaag ggggtatctt taaattcaaa aaaacggata aacattttat acacactttg       660
     tgtgatggac agttttatta tcaaaacgga atttattctg aacgggtggt aggaaaaagc       720
     ttacgtacta ttgatgcttc tattattcct ccccatttag ttccacaatt aatgaagtat       780
     tatcttcagg cgtgggaagg gaaagaaatt atatttgaat taccctggcc gaatgataaa       840
     actattattc ttattgcgct tagaccgatt aaacgaaatg gacaagttat tgaagttgtt       900
     ggttctacag tcgatataac cgaaaggaaa aaggtagaat cagaattaag ggcaactaaa       960
     gaattactgg aatcatttat aaaacataat gtagatgcga ttaccatatc tgatcgggag      1020
     ggacatattt tacaagctaa taaagcttat gaaaagatat ttggttggtc atcacacgaa      1080
     atcataggta aaagattacc ttgtgtgcct gatttcttaa tggatgaatc actcggaaat      1140
     atacagaaaa ttctaactgg agaatctgta gttacgagat tagaaacagt tagacaacgt      1200
     aacgatggaa gccttcttga tgtcagtctg acagtttcac ctattctaga tgtaagggga      1260
     aatgtgatag ctttatctgc aatatgtagg gacatttccg aaagaaaaca agcagaaaga      1320
     gaacggcaac gattacatca acaattaaga gatagtgaaa tgaaatatcg tgcactaatt      1380
     gaacaagcaa ctgatgcagt atatgttgta gagttgaatg aggatcaatt tccaagtcga      1440
     tttattgagg taaatcctgt tggatgtaac agatttggat atagtagaga agagcttctc      1500
     tcgatgccat ttcccaataa tgtaccacaa gattctccaa ttatcataca gttgttagaa      1560
     aaaattagag agggacagac ttctttcact ttgcaagatg aacatatttt tccaaccgga      1620
     aaaacaataa caaccgagtt tagtgtccgt atttttaact tgaatggcaa aaaagttttc      1680
     ttaagtatct ctcgtgatat cactgaacgg ttaaaaacag aagaattatt acgaaaatct      1740
     gaaaaactgg ctgtcgtagg acaattagcc actgcaatag ctcatgaaat taataatcca      1800
     ttaaccgcaa tgaaagggtt tatgcaatta ctaaaatcaa cagaaaatga gaataatcag      1860
     gggtatataa atatagtatc atcagagatt gagcgtatag aaagtattac gaatgaattt      1920
     atggcggtag ccaaaccaca ggtggtaagg atacaaccta atgatattag tgtgctaact      1980
     gatcaagttt tattgatact gcaacctcaa gcaatgatga ataatataca aattagaaca      2040
     gattatacac ctggtattcc attgattcca tgtgaaggaa atcaattaaa acaagtattt      2100
     gttaatattt taaaaaatgc aattgaatcc atgccaatgg gaggagaaat tctgattcaa      2160
     attgataaac ttgataatga tcaaataagc attcgtttta tcgatcaagg gtgtgggatc      2220
     ccaaaagaac gtataccata tctaggagaa cctttttaca gtattaagga agaggggatt      2280
     ggcttaggat taatgatttg ttataaaatt atcgaaacac atcaaggaaa ggtatttatt      2340
     gagagtgaag taaataaagg aacaacagtt gaagttactc tccctatttg tacaattcaa      2400
     aagtaa                                                                 2406
//

If you have problems or comments...

PBIL Back to PBIL home page