(data stored in ACNUC9435 zone)

EMBL: CP000904.PE193

CP000904.PE193       Location/Qualifiers
FT   CDS_pept        293937..294845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5653"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   sen:SACE_6215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5653"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46617"
FT                   /db_xref="GOA:A9VUP6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP6"
FT                   /protein_id="ABY46617.1"
FT                   /translation="MKGWIIMSSYFPKVGRLIGVISMLVILLSSFWLIWNGETNIRYSG
FT                   DHEGTMSFGNKWIPVIIGIFLVRFLPFHRKNYNPIQQHEPRHIMIQTFVLFLSGFLFTI
FT                   CLLIANFEGMALQLWFMISKIILLLLTPLMLLLFYQSNPNKERFKPVKSLVSNRWYRLT
FT                   PLMVIIIWGYFNFFSVFSTPFVSIGMDRTILIATLFLGFFINSVLEEIFYRVWLQTRLE
FT                   LLLGTWPAILLTSLLWASWHIAIHGSGHWGTDTATVITNLGIVGLFLGYLWARYRKVWV
FT                   IIIVHGFINAHPQQLLEILFN"
     atgaaagggt ggataattat gagcagttat tttccgaaag tggggaggct aattggtgta        60
     ataagtatgc ttgtcatttt gctttcatca ttttggctta tatggaatgg agaaacaaac       120
     attcgttata gtggggatca tgagggaacg atgtcttttg ggaacaagtg gataccagtt       180
     attatcggta tattcctcgt ccgtttctta ccatttcatc gtaaaaatta caatcccatt       240
     cagcagcacg aaccaaggca tatcatgatt caaacttttg tcttattctt gagcggattc       300
     ctcttcacga tttgtcttct catcgcgaac tttgaaggaa tggcgctcca attgtggttt       360
     atgatatcta aaattatttt attattgtta actccattaa tgcttctttt gttttatcaa       420
     agtaacccca acaaagaacg gttcaaacct gtaaaatcac tggtgagtaa tagatggtat       480
     cggcttacac cgcttatggt cattataata tggggttact tcaacttctt ttctgtattc       540
     tctacaccat ttgtttcaat aggaatggat cgaacgattt taatcgcaac tttattccta       600
     ggatttttta ttaatagtgt ccttgaagag attttttata gggtttggtt gcaaacacgt       660
     ttggaattat tactaggtac ctggccggca attcttctta cctcgctctt atgggcgagc       720
     tggcatattg caatacatgg ctctggtcat tgggggactg atacggccac ggtcattacg       780
     aaccttggta tcgtaggtct attccttgga tatttgtggg cgcgctatcg caaggtgtgg       840
     gtaattatta ttgtacatgg attcattaat gcacatccac agcaactact tgagatcttg       900
     tttaattaa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page