(data stored in ACNUC9435 zone)

EMBL: CP000904.PE195

CP000904.PE195       Location/Qualifiers
FT   CDS_pept        296827..299463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5655"
FT                   /product="Microbial collagenase"
FT                   /EC_number="3.4.24.3"
FT                   /note="PFAM: peptidase domain protein; Peptidase M9A
FT                   collagenase domain protein; Peptidase M9 domain; KEGG:
FT                   btk:BT9727_3286 microbial collagenase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5655"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46619"
FT                   /db_xref="GOA:A9VUP8"
FT                   /db_xref="InterPro:IPR002169"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR013661"
FT                   /db_xref="InterPro:IPR041379"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP8"
FT                   /protein_id="ABY46619.1"
FT                   /translation="MVKYSRISKLIVGVGLVTISCSGLQIQAETKEKNVKNVLQMEPVG
FT                   LRKSVDELAHPSNVQENGSFTKRLKLADLSQRPPMPNENAKQLVEEKKYSMAELNQLSN
FT                   KQLTDLLVTIQWYQIPELFQFNNDSLKFYQDDSRMQAIIAKLAEQGQAYTKDDSKGIET
FT                   LVEVLRSGFYLGFYHQELSKLSERVYHDKCLPALKTIAKNPNFKLGTTEQNKVISSYGM
FT                   LIGGASADVEVIQYAGEIFKQYNDNLSTFIEDRTKGDAVYNLMKEVDYEVQSYMNATGK
FT                   EPKDMLWYGKIDGFINEINRFALIGTVTDKNGWLINNGIYYASRFGKFYSTPTKGQQVV
FT                   TEAMGIYPYLGQQYFAAAEQIATNYGGIDANGKTVNLDQIREDGKKHYLPKTYTFDDGA
FT                   IVFKAGDKVSEEKIKRLYWAAKEVRSQYYRTVGSDKPLESGHADDVLTMVIYNSPDEYQ
FT                   FNRQLYGYETNNGGIYIEGTGTFFTYERTPQQSIYSLEELFRHEFTHYLQGRYEVPGLW
FT                   GQGEMYQNERLTWFEEGNAEFFAGSTRLDSVVPRKSIIGGLSNDPSKRYTAAQTLNAKY
FT                   GTWDFYNYSFALQSYMYNNRPDMFDKVHDLIRTNDVPGYDAYRSTLSKDNKLNEEYQTY
FT                   MQMLIDNRDKYTIPQVSDDYVAQHNPKPLSDVASDITNEAKLKNVKVTKNKSQFFNTFT
FT                   LQGTYTGSAAKGENEDWKVMNQATNDMLKHLAEKEWSGYKTLNAYFVNYRVNAAGQFEY
FT                   DVVFSGVNTEEGTAVEKEPNNSFDAANPLSLNALLRGNLSDQDQVDRFVIDVKDPKDLQ
FT                   ITVTNEQNLGLNWVLYSESDLNNYVTYATKRDGNKLLGNYNAKPGKYYLSVYKYGGGTG
FT                   NFTVEVK"
     atggttaaat attcaagaat ttctaaactg attgttggtg ttggactcgt gacaatatca        60
     tgtagtggtt tacaaattca agcagagaca aaagaaaaaa atgtgaagaa cgtattacaa       120
     atggagccgg taggattaag gaaatccgtt gatgagttag cgcacccttc gaacgtgcaa       180
     gaaaatggat catttactaa acgtttaaag ttagcagatt tatcgcagcg tccaccgatg       240
     ccaaatgaga atgctaaaca gcttgttgaa gaaaagaaat attcaatggc tgaattaaat       300
     caattaagca acaagcaatt gaccgatctt ctggttacga ttcaatggta tcaaattccg       360
     gagttatttc agtttaataa tgatagtctc aaattctatc aagatgatag ccgtatgcag       420
     gcaatcattg ctaagctagc agaacaagga caagcctata cgaaagatga ctcaaaagga       480
     attgagacat tagtagaagt tttacgctca ggtttttatt taggttttta tcatcaagaa       540
     ttaagtaaac taagtgaacg tgtctatcat gataaatgtt tgccagcttt aaaaacaatt       600
     gcgaagaacc cgaattttaa acttggtaca acagaacaaa ataaagtaat ttcgtcttat       660
     gggatgttaa ttggaggggc gtcagctgat gtagaagtta ttcaatatgc aggtgaaatc       720
     tttaaacaat ataacgataa tctttctacg tttattgaag atcgaactaa aggcgatgct       780
     gtatataatt tgatgaaaga agttgattat gaagttcaat cgtatatgaa tgctacagga       840
     aaagaaccaa aagatatgct gtggtatgga aaaattgatg gctttattaa tgagataaat       900
     cgttttgcac taataggtac agtaacagac aaaaacggat ggctaattaa taatggtatt       960
     tactatgcta gtcgttttgg caagttttat agtacaccaa caaaaggaca gcaagttgtt      1020
     acagaagcaa tggggatata tccatattta gggcaacaat attttgctgc agcagaacaa      1080
     attgctacta attacggcgg gatagatgca aatggaaaaa cggtaaattt agatcaaatt      1140
     cgagaagatg gtaagaaaca ttatttgcca aaaacatata catttgatga tggggctatt      1200
     gtctttaaag cgggagataa agttagcgaa gaaaaaatta aacgtttata ttgggcagca      1260
     aaagaagtac gatctcaata ttatcgtaca gttggtagtg ataaaccact tgaaagtgga      1320
     catgctgatg atgtgttaac aatggttatt tataatagtc cggatgaata tcaatttaac      1380
     cgtcaactat acggctatga aacaaataat ggtggaattt atattgaagg aacaggaacc      1440
     ttctttacat atgaacgtac accacagcag agtatttata gtttggaaga attgtttcgt      1500
     cacgaattta cacactattt acagggcaga tacgaagttc cgggattatg gggtcaagga      1560
     gaaatgtatc aaaatgaacg cttaacatgg tttgaagaag gaaatgcgga gttttttgca      1620
     ggctcaacgc gattagacag tgtagtaccg cgaaaaagta tcattggtgg attgtctaat      1680
     gatccttcga aacgttacac agcagcgcaa acattaaatg caaaatacgg aacgtgggat      1740
     ttttataatt actcgtttgc attgcaatcg tatatgtata ataaccgtcc tgatatgttt      1800
     gataaagtgc atgatttaat tcgtacaaat gatgttccag gttacgatgc gtaccgttct      1860
     acattaagta aagataataa attaaatgaa gaatatcaaa cttacatgca aatgctgata      1920
     gataatcgtg ataagtatac aattccgcaa gtatcagatg attatgtagc acagcacaat      1980
     ccaaaaccgc tttcagatgt tgcgtcagat atcaccaatg aagcgaagct aaaaaatgtg      2040
     aaggtaacaa agaataaatc acaattcttt aataccttca cactacaagg aacatataca      2100
     ggaagtgcgg caaaagggga gaatgaggat tggaaagtga tgaaccaagc aacaaatgat      2160
     atgctgaagc atcttgcaga aaaagagtgg agcggataca aaacattaaa tgcttatttt      2220
     gtaaattatc gtgtcaatgc cgctggacaa tttgaatatg atgttgtgtt tagcggagtg      2280
     aatacagaag aaggtactgc tgtagaaaaa gaaccgaata attcatttga tgcagcgaat      2340
     ccattatctt tgaacgcgtt attaagagga aacttaagtg atcaagatca agttgacaga      2400
     tttgttatcg atgtaaagga cccaaaagat ttacaaatta ccgttacgaa cgaacaaaac      2460
     cttggactga actgggtgtt atattctgaa tcagatctaa ataattatgt aacttatgca      2520
     acaaaacgcg atggaaacaa attgcttgga aattataatg cgaagccagg gaaatattac      2580
     ttaagtgtat ataaatatgg cggtggaaca gggaatttta ctgtagaagt aaaataa         2637
//

If you have problems or comments...

PBIL Back to PBIL home page