(data stored in ACNUC9435 zone)

EMBL: CP000904.PE196

CP000904.PE196       Location/Qualifiers
FT   CDS_pept        300541..301248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5656"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bca:BCE_3336
FT                   IS240 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5656"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46620"
FT                   /db_xref="GOA:A9VUP9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUP9"
FT                   /protein_id="ABY46620.1"
FT                   /translation="MEKENLFKWKHYQPELILLTVRWYLRYNLSFRNLVEMMEERGLSI
FT                   AHTTIMRWVHQYGPQLEEKVRHHLKSTNDSWRVDETYIKVKGQWMYLYRAVDSKGNTID
FT                   FHLSKSRDKQAAKCFFKKALAFSYVSKPRVITVDKNPAYPVAIQALKEEKHMPEGIKLR
FT                   QVRYLNNIVEQDHRFIKKRVRSMLGFKSFGTATSILAGVEAMHMIKKEQIDLRDQSVQN
FT                   QKEFIHQLFGLTA"
     atggaaaagg agaatttgtt caaatggaag cattatcagc ctgaactaat cttattaaca        60
     gtaagatggt acctacggta caatttgagc tttcgtaacc tggtggaaat gatggaggaa       120
     agaggattat caattgctca cacaacgatt atgcgctggg ttcatcaata tggacctcaa       180
     ttagaagaga aagtacgaca tcatctaaaa tcaaccaatg attcatggag agtcgatgaa       240
     acctatatta aagtaaaagg gcaatggatg tatttatatc gtgccgttga ttcaaaaggg       300
     aataccattg attttcatct aagtaaatca agagataaac aagccgccaa gtgctttttc       360
     aagaaagccc tggctttttc gtacgtttct aaacctcgcg tgataacagt agataagaac       420
     cctgcctatc ctgtagcaat tcaagcgttg aaagaagaaa aacatatgcc tgaaggcatc       480
     aagctaagac aagttagata tctcaataat atagtggaac aagatcatcg ttttattaag       540
     aaacgtgtgc gttctatgtt agggttcaag tcttttggca cagctacatc cattcttgca       600
     ggagtagaag ctatgcatat gattaaaaaa gaacagattg atttacggga tcagtctgtt       660
     caaaatcaga aagaattcat ccatcaattg tttgggctaa cagcataa                    708
//

If you have problems or comments...

PBIL Back to PBIL home page