(data stored in ACNUC9435 zone)

EMBL: CP000904.PE198

CP000904.PE198       Location/Qualifiers
FT   CDS_pept        301865..302185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5658"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46622"
FT                   /db_xref="GOA:A9VUQ1"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ1"
FT                   /protein_id="ABY46622.1"
FT                   /translation="MRARKETIPFREFMDRSYKDKEQKIRKYNSLSPFAFLHMSDQVLH
FT                   TYIALGVMGTILIGAVMLEKYLVRHDYISAAKFVSEGIYHGTRIGGVCLIGYVFVRIVI
FT                   MF"
     atgcgtgcta ggaaagaaac aattcctttt cgcgagttta tggatcggtc atacaaagat        60
     aaagaacaga aaatccgtaa atacaattca ttaagtcctt tcgcattcct tcatatgtcg       120
     gatcaggtat tacatactta cattgcatta ggagttatgg gaacgatttt aatcggagca       180
     gtcatgttag aaaaatactt ggtgcgacat gactatatat cagcagctaa atttgtaagt       240
     gaaggtattt atcacggaac gcgaattggt ggagtttgtt tgattggata tgtatttgtt       300
     cgtatcgtaa tcatgtttta a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page