(data stored in ACNUC9435 zone)

EMBL: CP000904.PE2

CP000904.PE2         Location/Qualifiers
FT   CDS_pept        1615..2730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5434"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46426"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ4"
FT                   /protein_id="ABY46426.1"
FT                   /translation="MAETGSVQNAVGNNIYPDLVLTRFPELFDERSGSKSNPNLQRWTN
FT                   LKDYNMAEHVNSLQDATMAIQRMLGELAQMPAAPKDANGKPITDPNVLLNLKRTSTVKS
FT                   RIDALETHDWYAEFDKRYGGPVWKFDKDKPTNPTIQQHRHLGSASGIPGMPEKIVLTEE
FT                   VQGKLPKANVDLTKTATGITGSDIYVESTSNTKVSDAINDKISETTGGTIAQNAELEVL
FT                   GKTNTRWTREFDSNDASSTGNTAVADGKTLLNKAIESGATAASDLLNAPLDGMHYGRYV
FT                   AIVRLSASSLPSNGLVEISAVNSKTNQVINKTTLNGTDFDTSGQYKTFYLIFNHDGSTK
FT                   IRVRKLATTSSVKVRFDYAIVEPVHPAVFDR"
     atggctgaaa ctggatcagt acaaaatgca gttgggaata atatttatcc cgatttagtt        60
     cttactcgtt tccctgaatt attcgatgag cgtagtggtt ctaaatcaaa ccccaacttg       120
     caacgatgga caaaccttaa agattacaac atggctgaac atgtaaactc cctgcaagat       180
     gctacgatgg caatacagcg tatgctagga gaattagctc aaatgccagc tgcaccaaag       240
     gatgcaaatg gaaaacctat tacagaccca aatgtgctac taaaccttaa acgaacttct       300
     acagttaagt ctcgtataga cgcacttgag actcatgact ggtatgctga gttcgataag       360
     cgatacggtg gaccagtatg gaaatttgat aaggataaac ctacaaatcc tacgattcaa       420
     caacaccgtc acttaggtag tgcttcaggg attcctggta tgccagagaa gattgttctt       480
     acagaagaag tacaaggtaa gcttccaaag gcaaatgttg atttaacaaa gactgctaca       540
     ggaattactg gttcggatat ctatgtagaa tcaacttcaa acactaaagt atccgatgca       600
     attaatgaca aaatctccga aacaacaggt ggaacaattg cacaaaatgc agaattagaa       660
     gtgttaggaa aaacaaacac tcgatggaca agagaatttg attctaatga tgcttcttca       720
     actggcaaca ctgcagttgc tgacggaaaa acgttactaa acaaagcaat tgagagtggt       780
     gctactgctg cctcagacct attaaatgct ccattagatg gaatgcatta tggtcgttat       840
     gttgcgattg tgagattatc cgcaagcagt cttccttcta atgggcttgt tgagatttca       900
     gcagtcaact caaagacaaa ccaagttatt aacaaaacta ctttaaacgg aacagacttc       960
     gatacaagtg gacaatataa aacattctac ttgatcttca atcatgatgg ttctacaaaa      1020
     atacgtgttc gaaaactagc tacaacttct tctgtaaaag ttcgtttcga ttatgcgatt      1080
     gttgaaccag ttcacccagc ggtatttgat cgctaa                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page