(data stored in ACNUC9435 zone)

EMBL: CP000904.PE20

CP000904.PE20        Location/Qualifiers
FT   CDS_pept        39615..40862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5452"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46444"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV12"
FT                   /protein_id="ABY46444.1"
FT                   /translation="MRPITLRNPNLNKGPSSSEEFNKLRNDIQTDITNLFDIVNSHDGI
FT                   ISENMDHILRENYFLQNRLKKLEGRVYELEKDYQNNSVDGESILTRSFYHASNIISSNA
FT                   NNPINIDTLHGIVTPVVVRSHDKIAYKNDLGEYILPSNLEASVFESSDVEPIDEETKQR
FT                   KFYAVNSSGITKAFDGDKNSFWVRQSESNENKCVTEVYGLIHVKIPQNISNNIYTNTIT
FT                   IHPSPEYSMSILDIQYKNQNGEWRRIETYPIKKVNNTDIPEEIVESGKLVFSFPRRQVT
FT                   ELQIKVKQPYWFKHDNKRIFMYGFQDIVVEYREYSQDTSEFTTKFSLEGTDRRFTNVNT
FT                   PKVTVPVGCPSLNDYTVKHELYFDEGLTEKFDFSTDIFQPIQTVYVKTLLKTAGDQVPI
FT                   LREIELPYRHEELEVL"
     atgcgcccga ttacattaag aaatccgaat ctaaacaaag ggcctagctc ttctgaagag        60
     tttaataaac tacgtaatga catccagact gatattacaa atttgtttga tattgttaat       120
     agtcatgatg gcataatctc tgagaatatg gatcatattt tacgtgaaaa ttacttctta       180
     caaaaccgtc taaagaagtt agaaggacgg gtgtatgagc tagaaaagga ttaccaaaat       240
     aacagtgtag acggggagag tatcctaact cggtccttct atcatgcaag caatattatt       300
     tcctcaaatg caaataatcc cattaatata gatacacttc acgggattgt taccccagtt       360
     gttgttagat ctcatgataa gattgcttat aagaatgact taggagaata catattacct       420
     agcaacctag aagcaagtgt atttgagtca tcagatgtag agccaattga tgaagaaaca       480
     aaacaacgca agttctatgc agtaaattct agtggtatta ctaaagcatt tgatggagat       540
     aagaactcat tttgggttcg tcaatctgaa tctaacgaaa acaaatgcgt aacagaagtg       600
     tatggattaa ttcatgtgaa aattccacaa aatatttcta ataacattta tacaaacaca       660
     attactattc atccatctcc ggagtactct atgagcattc ttgatattca atataagaat       720
     cagaatggag agtggaggcg tattgaaacc tacccaatta aaaaggtaaa caatacagac       780
     attccagaag agattgttga atctggtaag ttagtattct cattcccaag aagacaagta       840
     acagaattac aaattaaagt aaaacaacct tactggttta agcatgataa caaacgaatt       900
     tttatgtatg gattccaaga catcgttgtt gaataccgtg aatattctca agatacatcg       960
     gaattcacaa caaagttctc tttagaagga acagatcgtc gttttacaaa tgtaaacacg      1020
     ccaaaggtaa cagtacccgt tggatgtcca tcacttaatg attacactgt aaaacacgaa      1080
     ttgtactttg atgaaggact aacggagaag tttgattttt caacagatat tttccaacca      1140
     attcaaactg tatatgtaaa aacactttta aaaacagcag gggatcaggt accaatctta      1200
     cgcgagattg aattacctta ccgacatgaa gaattagaag tgctataa                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page