(data stored in ACNUC9435 zone)

EMBL: CP000904.PE200

CP000904.PE200       Location/Qualifiers
FT   CDS_pept        303354..303965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5660"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK0554 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5660"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46624"
FT                   /db_xref="InterPro:IPR025855"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ3"
FT                   /protein_id="ABY46624.1"
FT                   /translation="MMKSRDKGILNDLNRFRCMSRDDIIDLHFQGLKNAVTCCNTVMKR
FT                   LRRDGYVDANVLQHPYIYFPQPSSIRKTSQKIPHFLGIVDVYKQLVHYENPKLFEVEPK
FT                   YRKEYMEPDAFTIWRRSPFFIEVQKSVYSKKLMQDKINRYELYFHNQEWHNEYWQPKAS
FT                   KFFPSILIITDKHYDVQSPYFRIFQANSIESFMNNLTVKS"
     atgatgaaga gtagagataa aggaatcctg aatgatttga atcgatttag atgcatgtcc        60
     cgtgacgata ttattgactt gcattttcaa ggcttaaaga atgcggtaac ttgttgtaat       120
     acggttatga aacgattaag aagagacggc tatgttgatg ctaacgtatt gcagcaccca       180
     tacatttatt ttccacaacc cagttctatc agaaaaacga gtcaaaaaat tcctcatttc       240
     cttggtattg tggacgtata caaacaactc gttcattatg aaaatcctaa actattcgaa       300
     gttgaaccaa agtataggaa agaatatatg gagccggatg cttttacaat atggcgtaga       360
     tcgccattct ttattgaagt tcaaaagtca gtgtacagta aaaagctaat gcaagataag       420
     ataaatagat atgagttata cttccataac caagaatggc ataatgaata ttggcaaccg       480
     aaagcttcta aattctttcc ttcaatcctt atcattactg acaaacatta cgacgttcaa       540
     tctccttatt tccgtatatt ccaggcgaat tctatagaaa gttttatgaa taatttaaca       600
     gtgaaatcat aa                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page