(data stored in ACNUC9435 zone)

EMBL: CP000904.PE201

CP000904.PE201       Location/Qualifiers
FT   CDS_pept        304362..305009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5662"
FT                   /product="antigen"
FT                   /note="KEGG: bce:BC2461 antigen"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5662"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46625"
FT                   /db_xref="GOA:A9VUQ4"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ4"
FT                   /protein_id="ABY46625.1"
FT                   /translation="MKNTSKKQIIILFFISILGLGTMLGILYFNHKTNIQQNKALATEK
FT                   RVLQYEPTLKKELEKYNLGGKTAVLLGIMYQESRGEGNDPMQSSESLGLKPNEIQETSL
FT                   SIKQGVKHFAKMYKYGTEKDVSMDTIIQSYNMGPGYIDFIASQEVKQHSEDSAKKFSKM
FT                   KVNQNPAMYTCGGNKNNFRYPYCYGDFTYATKVNEKTILIEELLRNVHDSSK"
     atgaagaata cgagtaaaaa acaaattatt atattattct ttattagtat tttaggttta        60
     ggaacaatgc ttggaatact atattttaat cataaaacta atattcaaca aaataaagcg       120
     cttgctaccg aaaaacgtgt attgcaatat gagcctacct tgaaaaaaga attagaaaaa       180
     tataatttag gagggaaaac agcagtttta ttaggaatta tgtaccaaga gagtagaggt       240
     gagggaaacg accctatgca gtcatctgaa tcacttggat taaagccaaa tgaaattcaa       300
     gagacaagct tgagcattaa acaaggggta aaacactttg ctaaaatgta caaatatgga       360
     acggaaaaag atgttagcat ggatacaatt attcaaagct ataatatggg gccagggtat       420
     attgatttta ttgctagtca agaagttaaa caacactcgg aagattcggc caaaaagttt       480
     tctaagatga aagttaatca aaacccagcg atgtacactt gtggtggaaa taaaaataat       540
     tttaggtatc catattgtta tggtgatttc acatatgcca caaaggtgaa tgaaaaaaca       600
     atacttattg aagaacttct tcgaaatgta catgactctt ctaaataa                    648
//

If you have problems or comments...

PBIL Back to PBIL home page