(data stored in ACNUC9435 zone)

EMBL: CP000904.PE202

CP000904.PE202       Location/Qualifiers
FT   CDS_pept        complement(305092..305799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5663"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bca:BCE_3336
FT                   IS240 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5663"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46626"
FT                   /db_xref="GOA:A9VUQ5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ5"
FT                   /protein_id="ABY46626.1"
FT                   /translation="MEKEYVFKWKHYQPDIILLTVRWYLRYNLSFRDLVEMMEERGLSI
FT                   SHTTIMRWVHQYGPELDKRIRSHLKQTNDSWRVDETYIKVKGQWMYLYRAVDSKGNTID
FT                   FYLSKTRDQKAAKHFFKKALQSFHVSKPPVITVDKNPAYPIAIEQLKKEKSIPGGMRLR
FT                   QQKYLNNIVEQDHRFIKKRIRSMLGFKCFDTATSILSGVEVMHMIKKEQVDLRDQSVQN
FT                   QKEFIHQLFGLAA"
     atggaaaagg aatatgtatt caaatggaaa cattatcagc ctgatattat tttgttaacg        60
     gtaagatggt acctacggta caacctcagt tttcgtgatt tagtggaaat gatggaggaa       120
     cggggcttat ccatttctca tacaacgatt atgcgttggg ttcatcagta cggtcctgaa       180
     ttggacaaac gaatccgaag tcaccttaaa caaacaaatg actcctggag agtcgatgaa       240
     acatatatca aagtaaaagg tcaatggatg tacctgtatc gtgctgttga ttcaaaagga       300
     aatacaatcg atttttacct aagcaaaaca agagaccaga aggctgcaaa gcactttttc       360
     aagaaggcct tgcagtcttt tcatgtttca aaacctcctg ttataacagt cgataaaaat       420
     ccagcttatc ctattgcaat tgaacagttg aaaaaagaaa aaagcatacc tggtggtatg       480
     cgacttagac aacaaaagta cttgaataac atagtagaac aagatcatcg ttttataaag       540
     aagcgaattc gttctatgct agggttcaaa tgttttgaca cagctacatc cattctttct       600
     ggagtagaag tcatgcatat gattaaaaaa gaacaggttg atttacggga ccagtctgtc       660
     caaaatcaaa aagaattcat ccatcaattg tttgggcttg cggcataa                    708
//

If you have problems or comments...

PBIL Back to PBIL home page