(data stored in ACNUC9435 zone)

EMBL: CP000904.PE203

CP000904.PE203       Location/Qualifiers
FT   CDS_pept        complement(306853..308562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5664"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: baa:BXA0023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5664"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46627"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ6"
FT                   /protein_id="ABY46627.1"
FT                   /translation="MGKSFIIQNQRSLNGETTNAVLVTLKSWQKFVEAFEKKYYSYKDT
FT                   YLEDILQHMTYEERIADVEGFVEQAKPSFSRRAMSALAEKTGRKHKLYGITNADLEVFL
FT                   YLHKKCYTNGVIPNVTIHMMWEDYKQYKEEFAHIQHSQFYIALKKLSIHNIIAIENGVD
FT                   GRYTIKLTHFMNEETEKTNPYVYISPVVFTKAFFKLSVAAKKLFLDIAMQQHTETTLKR
FT                   SLDKQDERGNKTHFGGMYRFLHKKYPHQIRAVIEELTTALPCTENPLFKICKMQKGVKH
FT                   TKRYTTLYLSIHSDFLCTKESGEEQHRDPFTPKATYARKAKFIESVLQEMNIGELSSDM
FT                   NKFIHVLKHTCHRQIRGVIRGLRDMVDRKEGYPTKIVYTLKKLLHQTSQYQILDTAAKE
FT                   GIYPLIAQHIPKERNSDREQAVFNFGLHYSMYSLHSIKKMFKNVHALLKQKFAVPVTEE
FT                   SYHRNYLKYQEETLFRKYAYDQGVNLHAYIALEIEMREKLKVRGHKERTIPSDVREWFI
FT                   EAIDKLPQEKLRVIELPKQFNLLEFMRTFEHLIRAGATITAPDQVLSAMEIK"
     atggggaaat catttattat tcaaaatcag cgtagcttaa atggtgaaac aacaaatgca        60
     gttttagtaa cactaaagtc ttggcaaaag tttgtagaag catttgaaaa gaagtactac       120
     agctataaag atacatattt agaagatatt ctgcagcaca tgacatacga agaacgtatt       180
     gcggatgtag aaggctttgt cgaacaagct aaaccatctt tttcacgtcg tgcaatgtct       240
     gcacttgcag agaaaacagg aagaaaacat aaattatatg gtattacgaa tgcagatctt       300
     gaagtgttct tatatctaca taagaaatgt tatacaaatg gtgtcattcc aaatgtaacg       360
     atacatatga tgtgggaaga ttacaagcaa tataaagaag aatttgctca tatccagcac       420
     tcacaattct atatcgctct aaagaaatta agcatacata acataatcgc tatcgaaaat       480
     ggcgtagatg gccgctatac aatcaaactt actcatttta tgaatgaaga aacagaaaag       540
     acaaatccat acgtatatat tagtcctgtt gtatttacaa aggctttctt taagctatct       600
     gtagcagcta agaaactatt cttagacatt gctatgcaac aacatacaga aacaacgtta       660
     aagcgttctt tggacaagca ggatgaaaga ggtaacaaaa ctcactttgg tgggatgtat       720
     cgtttcttac ataaaaaata tccgcaccag atccgtgcgg ttatcgaaga attaacaact       780
     gcattaccgt gtacggagaa tcccctattc aaaatttgca aaatgcaaaa aggtgtaaag       840
     catacaaagc gatatacaac cttatatcta tctatccatt cggacttctt atgtacgaaa       900
     gaatccggag aagagcaaca cagggatcca tttacaccaa aagctaccta tgctcgtaaa       960
     gcgaaattta ttgaatcagt cctacaagaa atgaatatcg gtgaactttc ttcagacatg      1020
     aataaattca ttcatgtttt aaagcatact tgtcatcgtc aaattcgtgg tgtgattcgt      1080
     ggacttcgtg acatggttga tcgaaaagaa ggatatccaa cgaaaattgt atatacattg      1140
     aaaaaactat tgcatcaaac atctcaatat caaattcttg atacagcagc aaaagaaggt      1200
     atctatcctc ttattgcaca gcatatacca aaagagagaa atagtgaccg cgaacaagct      1260
     gtctttaatt ttggtctaca ttattcaatg tactctcttc atagcattaa gaagatgttt      1320
     aaaaatgtgc atgcactact caagcagaag tttgcagtac cagtgactga agaatcttat      1380
     caccgtaatt acctaaaata ccaggaagaa acgttattta gaaaatatgc atatgatcag      1440
     ggagtgaatc tccatgcata tatcgcttta gaaattgaaa tgcgtgaaaa attaaaagtt      1500
     cgtggccata aagaacgcac gattccaagt gatgtacgtg aatggtttat cgaagcaatt      1560
     gataaactac cacaagaaaa acttcgtgta attgagctgc caaagcaatt taatttacta      1620
     gagtttatgc gtacctttga acacttaata cgtgctggtg caacaataac agctccagat      1680
     caggtgctaa gcgcaatgga aataaaataa                                       1710
//

If you have problems or comments...

PBIL Back to PBIL home page