(data stored in ACNUC9435 zone)

EMBL: CP000904.PE205

CP000904.PE205       Location/Qualifiers
FT   CDS_pept        311718..312194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5666"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   oih:OB0379 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5666"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46629"
FT                   /db_xref="GOA:A9VUQ8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ8"
FT                   /protein_id="ABY46629.1"
FT                   /translation="MKLNNWDEISIEKSTNIGKEEMELLLLADPSPEVVNGYLKQGDCF
FT                   VLKKDAITVGIMILIPTRPETIEIINIAVSEKEQGKGYGKYLLGFAIDYAKKEKYKTIE
FT                   IGTGNSSLMQLGLYQKCGFRITNVDRDFFLRNYEEEIYENGIQCIDMIRLTQYL"
     atgaaattaa ataattggga tgaaattagt attgaaaaaa gtacaaacat tggtaaagaa        60
     gaaatggagt tattattact agctgatcct tcaccagaag tagttaatgg ataccttaaa       120
     caaggggact gttttgtttt gaaaaaggat gctattactg taggtattat gattttaatt       180
     cctactcgtc ctgaaacaat tgaaattata aatatagcag tttctgaaaa agaacaggga       240
     aaagggtatg ggaaatattt gcttgggttt gctatagact atgctaaaaa agagaaatat       300
     aaaaccatag aaatagggac gggaaattct agcttaatgc aattaggcct ttatcaaaaa       360
     tgtgggttta gaataacaaa tgtggatagg gattttttct tacgcaatta tgaagaggaa       420
     atatatgaaa acggtattca atgtatagat atgattaggt taacgcaata tttataa          477
//

If you have problems or comments...

PBIL Back to PBIL home page