(data stored in ACNUC9435 zone)

EMBL: CP000904.PE206

CP000904.PE206       Location/Qualifiers
FT   CDS_pept        312921..314249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5667"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase;
FT                   6-phosphogluconate dehydrogenase NAD-binding;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase; KEGG:
FT                   bay:RBAM_031240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5667"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46630"
FT                   /db_xref="GOA:A9VUQ9"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUQ9"
FT                   /protein_id="ABY46630.1"
FT                   /translation="MVTVLNNEIKKTLVEKIVNKSACIGYIGLGYVGLPSALKCLEVGY
FT                   TVRGFDKNLTKIEKLECGTSYISDIQDTEIQDALHTNRFFISTEMNYINECDVVVICVP
FT                   TPLEKDSKQPDLTYIHSAVNELVKYIRKGTLIILESTTYPGTTREEILYKLEHETNFEI
FT                   GTDIFVAYSPERIDPANKSFSIQDIIKIVGGVTPNCTDCAAAFYSHLIKGIHKVSSPEV
FT                   AETAKLLENTYRFINIAFINEMTQICNELNINIWEVIDASGTKPFGFQKFYPGPGVGGH
FT                   CIPIDPIYFKWIANNKDLATKMIDVAQEINENMPNYIIKRALQLLQDEDGKNVLMIGVA
FT                   YKKNVNDARESSALDIMNGLMLEGYNVDYHDPFIEELIVDNHKVKKSINLTTNALNKYH
FT                   LIIVHTDHDCINFNLLNGVNCLILDTRNILKDQSIYKKNIICL"
     atggtcactg tattaaataa tgaaattaaa aaaacattag ttgaaaaaat tgtaaataaa        60
     agtgcgtgta ttgggtatat tggtctagga tatgttggac taccatcggc tcttaaatgt       120
     ttagaagtag gttatacggt aagaggattc gataaaaacc tcactaaaat agaaaaatta       180
     gaatgtggaa caagttatat cagtgatatt caggatactg aaattcaaga cgctttacat       240
     acaaatagat tttttattag tacagaaatg aattatataa atgaatgtga tgttgttgtt       300
     atatgtgttc ctactccttt agaaaaagat agtaaacaac cagatttaac atatattcat       360
     tcagcagtta atgaattagt caaatacatt agaaagggta cattaattat tctagaaagt       420
     actacttatc caggtacaac aagagaagag attttatata aattagaaca tgaaactaat       480
     tttgaaattg gtacagatat ttttgtagca tactccccag agaggattga ccctgcgaat       540
     aagtcatttt caatccaaga tattattaaa attgtaggtg gagttacgcc taattgtaca       600
     gattgtgctg cagcctttta tagtcaccta attaagggga ttcataaggt tagtagtcca       660
     gaagtggcag agacagcgaa gttattagaa aacacttacc gttttataaa tattgctttt       720
     attaatgaaa tgacacaaat atgtaatgaa ttaaacatta atatttggga agtaattgat       780
     gcctctggga ctaagccgtt tggatttcaa aaattctatc caggtcctgg tgtaggagga       840
     cattgtattc caattgatcc tatatatttt aaatggattg caaataataa agatttagca       900
     acaaaaatga ttgatgtagc acaagagatt aacgaaaata tgccaaatta tattattaaa       960
     agggcattac agttactaca agatgaagat ggaaagaatg ttcttatgat tggcgtagca      1020
     tataaaaaaa atgttaacga tgccagagaa tcgtcagctt tggatattat gaatggttta      1080
     atgttagaag ggtataacgt cgattatcat gatccattta ttgaggagct aattgtggac      1140
     aatcataaag taaaaaaatc tattaattta actacgaatg cattaaataa ataccattta      1200
     attattgttc atacggatca tgattgcatt aattttaatt tactcaatgg agtaaattgc      1260
     ttaattttag atacaagaaa catattaaaa gatcagtcaa tatataaaaa aaatattata      1320
     tgtttgtag                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page