(data stored in ACNUC9435 zone)

EMBL: CP000904.PE207

CP000904.PE207       Location/Qualifiers
FT   CDS_pept        314258..315415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5668"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; aminotransferase class-III; KEGG: bay:RBAM_031230
FT                   SpsC1"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5668"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46631"
FT                   /db_xref="GOA:A9VUR0"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR0"
FT                   /protein_id="ABY46631.1"
FT                   /translation="MVEFIPFYRPEINDEDVEGVIRALKSGWLSKGPKVIEFEESLKEY
FT                   LNTGHVVSCNSGTAALHLALLSLGIGVEDEVIVPSFTFCSSVNVIMHVGAKPVFVDIDE
FT                   EDLCLDLHDVKRKITKKTKAIIAVHFAGYPAKLQELQKLCKEHGLFLIEDAAHALGTKY
FT                   DNTLIGTHGDIICFSFYATKNITTGEGGALVTKNEEIAEKARLYGWHGITKNAWNRYGE
FT                   KGSWRYDVLLPGFKYNMMDLQASLGISQLKRADEMIEKRRRIAEIYQKELKEIQEYITL
FT                   PNYVNNPSIKHAWHLFVIKINPNSPISRDQMIQEMKKRNIGLSVHFIPVHMHPYYQERF
FT                   NVHLPKTEEVFDQIISLPLYSALTENEVEHIVTSLKSLYQLKVGR"
     atggtagaat ttattccttt ttatcgacca gaaataaatg atgaagatgt tgagggagtt        60
     attcgtgctc ttaagtctgg atggctttca aaggggccaa aagtgataga gtttgaagag       120
     agtttaaaag aatatctaaa tactggacat gtagtaagtt gcaattcagg gactgccgca       180
     ttgcatttag cattattgtc tttgggaatt ggagtagaag atgaagtaat agttccaagt       240
     tttacttttt gttctagtgt aaacgttatt atgcatgtag gtgcaaaacc agtatttgta       300
     gacatagatg aagaggattt atgtcttgat cttcatgatg ttaaaagaaa aattactaaa       360
     aaaactaaag caattattgc tgttcatttt gctggatacc cagccaaatt acaagaactt       420
     caaaagctat gtaaagaaca cgggttattt ttgatagagg acgcggcgca tgcattaggg       480
     actaaatatg ataatacctt gattggtaca catggagata ttatttgttt tagtttttat       540
     gctaccaaaa atataacaac aggtgaaggt ggagcgttag ttactaaaaa tgaggagatt       600
     gctgaaaaag ctagattata tggctggcat ggtatcacca agaatgcatg gaatcgttat       660
     ggcgaaaaag gaagttggcg ttatgatgtt ctattacctg gatttaagta taacatgatg       720
     gatctgcaag ctagcttagg gattagtcag ttaaaaagag ctgatgaaat gattgaaaaa       780
     cggagaagaa tagcggaaat ataccaaaag gaattaaaag aaatccaaga gtatataaca       840
     ttacctaact atgtaaacaa tccaagtata aaacatgcat ggcatttatt tgttataaag       900
     attaatccta attctcctat cagtagagat cagatgattc aagaaatgaa aaagagaaat       960
     attgggctga gtgttcactt tattcccgtt catatgcatc catattatca agagagattt      1020
     aatgtacatt tacccaaaac agaagaagta tttgatcaaa ttatttcatt accattgtat      1080
     agtgcactta cagaaaatga ggttgaacat atcgttacgt ctttaaaaag tttataccaa      1140
     ttaaaggtag ggaggtaa                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page