(data stored in ACNUC9435 zone)

EMBL: CP000904.PE208

CP000904.PE208       Location/Qualifiers
FT   CDS_pept        315422..316345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5669"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; KEGG: bay:RBAM_031220
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5669"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46632"
FT                   /db_xref="GOA:A9VUR1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR1"
FT                   /protein_id="ABY46632.1"
FT                   /translation="MKIGVIGGGGFIGKHVTKELIARGYEVIIFDKFKPSMDVPFEEID
FT                   ILDIATLREKLINVDGVIHLAALVGVDNCRSNEEDVVRVNFEGTKNIVEVCIENGIGKL
FT                   LFSSSSEVYGDGVSVPFKENDVKIPKSAYGKAKLMSEDFLKEYANNSFKVRVVRYFNVY
FT                   GSQQNENFVISKFLKQAHNGENMTIYGDGQQIRCFSYISDIVNGTILAFEYERENFADF
FT                   NIGNNKPISMEELAGKINELMGNKSEIEFLNLGDEGVRDSNIEIFRRIPSIEKAQLLLN
FT                   YQPVISLNRGLEKIIEEKYGNTVSIS"
     atgaagatag gagttattgg tggcggtgga tttattggta aacatgttac aaaggagtta        60
     atagcaagag gttatgaagt aattatattt gataaattta aaccaagtat ggatgttcct       120
     tttgaagaaa ttgatatctt agatattgcg acattaagag aaaagcttat taatgtggat       180
     ggggtcatac atttagctgc attagtaggt gttgataatt gtcgttcaaa tgaagaagat       240
     gtagtaaggg tgaattttga aggcacgaaa aatattgtag aagtttgtat agaaaatgga       300
     ataggtaagt tattattttc ttctagttct gaggtgtatg gggatggtgt gagtgttccg       360
     tttaaagaaa atgatgtcaa aattcccaaa tcagcttatg gaaaagctaa attaatgtca       420
     gaagattttt tgaaagaata tgctaataat agttttaaag tcagagtggt acgttatttt       480
     aatgtatacg gttcacaaca aaatgaaaac tttgtgattt ctaagttttt aaaacaagct       540
     cataacggcg aaaatatgac tatttatggg gacgggcagc aaattagatg ctttagttat       600
     attagcgata ttgttaacgg aacgatatta gcatttgaat atgaaagaga gaattttgca       660
     gattttaata taggaaataa caagcctata tctatggagg aattagcggg gaaaatcaat       720
     gagttaatgg gaaacaaaag tgaaattgaa tttcttaatt taggggatga gggagtaaga       780
     gattctaata ttgaaatatt cagaagaata ccttcaatag agaaggctca attattatta       840
     aactatcagc cggttatttc attaaataga ggattagaga aaataataga ggagaaatat       900
     ggaaacacag tatctatatc ctaa                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page