(data stored in ACNUC9435 zone)

EMBL: CP000904.PE209

CP000904.PE209       Location/Qualifiers
FT   CDS_pept        316320..317561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5670"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; KEGG:
FT                   bay:RBAM_031210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5670"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46633"
FT                   /db_xref="GOA:A9VUR2"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR2"
FT                   /protein_id="ABY46633.1"
FT                   /translation="METQYLYPKNPKKIKYPIYPSFWSVFDHIYFLKSIYRSNHSNLKE
FT                   SLQTLYPNSEIILTNSGSSALVAGLKYLNIKKEDEVILSNFNCPNVIEAVLTVGAKPVL
FT                   IDLTTDYSLSLNKIKKYSNENTRAIILTHVYGCHEDLEVINWARDNDIYIIDDAAQAMF
FT                   SYQNEKSIGSLGDIGILSFGGTKPIPSIGGGALLLNRTVNDLCDMDEEKKAEVFLDYKN
FT                   HLKTQLALRIKKNRLLSLFTDYWEKLGILPSYNDSKLDSLPEETEVIYPKTMSTLRSLL
FT                   IDRHLKRMKKILEINIYNASLCYTMLQSIEEKYGVKIIFSAQNVYLNYFTIIFKEPSDR
FT                   YECSVYLAGKGIQTCWNYLPLSEIPIFSKYATESENIEFLWSRVLSIPFKYPLRKKDLK
FT                   YICSQILIYLEKKK"
     atggaaacac agtatctata tcctaaaaat cctaaaaaaa ttaagtatcc aatatatcct        60
     tctttttgga gtgtatttga tcatatatat tttttgaaaa gtatatatag atccaatcat       120
     tctaatctaa aagagagttt acaaactctc taccctaatt ccgaaattat attaactaat       180
     agtggttcgt cggcattagt agcagggtta aagtatctaa acataaaaaa agaggatgaa       240
     gtaattttat caaattttaa ttgtcctaat gtaatagagg ctgtattaac agtaggagca       300
     aaacctgtat taattgattt gactactgat tactcacttt ctcttaataa aataaaaaaa       360
     tattcaaatg aaaatacaag agcaattatt cttacacatg tgtatggatg tcatgaagat       420
     ttagaagtta ttaattgggc cagagacaat gatatttata taattgatga tgcagcacaa       480
     gcaatgttct cttatcaaaa tgaaaaatca attggtagtt taggtgacat tggaatttta       540
     agttttgggg gaactaaacc catcccgagt atagggggag gagcgttact tcttaatcgt       600
     acggtaaatg acttgtgtga catggatgaa gaaaagaagg cagaagtgtt tttagattat       660
     aaaaaccacc ttaaaacgca attagcttta agaatcaaga agaataggct actgagttta       720
     tttactgatt attgggaaaa gttaggaatt cttccttcct ataatgatag caaattggat       780
     tctttgccag aggaaacgga agttatatat ccaaaaacaa tgtccacatt acgttcattg       840
     ctaattgata gacacttaaa gagaatgaaa aagattttag aaattaatat atataatgct       900
     agtttgtgtt atacgatgct gcaatcaatt gaagaaaagt acggggtaaa gattatattt       960
     tcagctcaga atgtatattt gaactatttc actattattt tcaaagaacc atctgataga      1020
     tatgaatgtt ccgtatattt ggctggaaaa ggaatacaaa cttgttggaa ttatctacct      1080
     ctaagtgaaa tccctatatt ttccaagtac gccactgagt cagaaaatat agaattttta      1140
     tggtcaagag tattatcaat accttttaaa tatccgttaa ggaaaaaaga ccttaagtat      1200
     atatgtagtc aaattctaat atatttagag aaaaagaagt aa                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page