(data stored in ACNUC9435 zone)

EMBL: CP000904.PE21

CP000904.PE21        Location/Qualifiers
FT   CDS_pept        42449..42820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:BCZK4221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5453"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46445"
FT                   /db_xref="GOA:A9VV13"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV13"
FT                   /protein_id="ABY46445.1"
FT                   /translation="MEESKKKGEEINDKYPHYKDVNEDALTVSLEQYDQIKVGISVDKV
FT                   IEVAGYPIFSETTKLFSIFGYLGHGGEGSMTITFDNYLYKVSLFFVLGICFFRLMAAWC
FT                   YSFKYSKGYYNEIFTSISL"
     gtggaggaat ctaagaagaa gggtgaggaa attaatgaca aatatccgca ttataaagat        60
     gtgaatgaag acgcactaac agtatcacta gaacagtatg atcaaattaa ggtcggaatt       120
     tctgtcgaca aagtcataga ggtagcagga tatcctatat tcagcgaaac aactaagtta       180
     ttctctattt tcggatatct aggtcatggt ggagagggtt cgatgactat aacgtttgac       240
     aattatttat ataaggttag cttatttttt gttttgggta tttgcttttt taggttgatg       300
     gcggcgtggt gctactcttt taaatatagt aagggatact acaatgagat attcactagt       360
     atctcattgt ag                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page