(data stored in ACNUC9435 zone)

EMBL: CP000904.PE210

CP000904.PE210       Location/Qualifiers
FT   CDS_pept        317573..318454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5671"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bay:RBAM_031200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5671"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46634"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR3"
FT                   /protein_id="ABY46634.1"
FT                   /translation="MEIEICTDAQYWDACMEEYNGSVFHCYEWGKLMELLPGVQFFPVL
FT                   IKTRDTVVLSPIYVQDGRVLGSLIGYGGPVIIGQDKIDFAFYESIINRKFENKIQKLLL
FT                   PITINPFQSYSDEKWEYKETYMLDLPNNFEDLWTSCSGKARTSVRYARKQNVEIRPIAL
FT                   EELDEFYNLYQEHNNSIGASYSFSREFFYYLFINLKERILFLGAFLEEELISSSIFIMD
FT                   KQVLYYWININNIKGKNTQSSYLLLNVAFELAIHNKLKYADLGYSHNKGIARPKIYWGA
FT                   VLKKCFCLKERI"
     atggaaatcg aaatatgtac tgatgcccaa tattgggatg cttgtatgga agaatataat        60
     ggttctgtat tccattgtta tgaatgggga aaattaatgg aattattacc tggtgttcaa       120
     ttttttccag tattaattaa aacaagggat acagtagttt tatctcctat atatgtacag       180
     gatggtaggg tgctgggaag tttaattggt tatggaggcc ctgtaatcat tggccaagat       240
     aaaatagatt ttgcatttta tgaatcgata ataaatagga agtttgaaaa taaaattcaa       300
     aaacttttat tacctataac aataaatcct tttcaaagtt atagtgatga aaagtgggag       360
     tataaagaaa cttatatgtt agatctacca aataattttg aggatttatg gacatcgtgt       420
     tcaggaaaag ctaggacaag tgttagatat gcccgtaaac agaatgttga aattcggcct       480
     atagccttag aagaattaga tgaattttac aatttatatc aggaacataa taacagtata       540
     ggagcgagtt attcatttag tagagagttt ttttattatt tatttattaa tttaaaagaa       600
     aggatccttt tcttaggagc attcttagaa gaagaactaa ttagttccag tatatttata       660
     atggataaac aagttttata ttactggatt aatattaata atatcaaagg gaaaaataca       720
     caatcttcat acttactact aaatgttgcg tttgaattag caattcataa taaattaaag       780
     tatgcggatt taggatattc acataataaa gggattgcta gaccaaagat atactgggga       840
     gcagttttga aaaaatgttt ttgtttaaaa gagaggattt aa                          882
//

If you have problems or comments...

PBIL Back to PBIL home page