(data stored in ACNUC9435 zone)

EMBL: CP000904.PE211

CP000904.PE211       Location/Qualifiers
FT   CDS_pept        318458..319147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5672"
FT                   /product="WbqC-like family protein"
FT                   /note="PFAM: WbqC-like family protein; KEGG:
FT                   bay:RBAM_031190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5672"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46635"
FT                   /db_xref="InterPro:IPR014985"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR4"
FT                   /protein_id="ABY46635.1"
FT                   /translation="MIISGHQPSYLPWYGFFEKIHKSDVFVFHDIAQFEKKGFLNRNRI
FT                   KTSQGVSWLTVPMQMKNYKEIPLNKLKIDNTQDWERKHWKTIRINYSNAPYFNVYKDYL
FT                   ENFYSEKWDNLNSMNMNFIHFIIQELNIDTELYYASELEGITGKKSDFVLELCQKFNAN
FT                   TYYSGSLGQDYLIESDFEHENIEIIYQRIREYSYPQLFGEFIPHLSMLDVLLNCGPEET
FT                   EKLIKGV"
     atgattatta gtggccacca accaagttat ttaccttggt atggtttttt tgaaaaaatt        60
     cataaatcgg atgtgtttgt atttcatgat atagcacaat ttgaaaagaa aggtttttta       120
     aatagaaatc gtattaaaac ttcccaagga gtatcctggt taacggttcc gatgcaaatg       180
     aaaaattata aagaaatccc attgaataag ttaaagatag acaatacaca agattgggag       240
     cgaaagcatt ggaagacaat aagaattaat tactctaatg cgccctattt caatgtatac       300
     aaggattatc tagaaaattt ttattcagaa aaatgggata atctcaatag tatgaatatg       360
     aactttattc attttattat tcaagaatta aatattgata cggaattata ttatgcatca       420
     gagctagagg ggattacagg gaaaaaaagt gattttgtat tagagctttg tcaaaagttt       480
     aatgccaata cttattattc tggaagttta ggtcaagatt atttaataga aagtgatttt       540
     gagcatgaaa atatagaaat catataccaa aggataagag agtattctta cccacagtta       600
     tttggagagt ttataccgca tttatctatg ctagatgttt tattaaattg tggtccagag       660
     gaaacagaaa aattaattaa aggagtttaa                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page