(data stored in ACNUC9435 zone)

EMBL: CP000904.PE212

CP000904.PE212       Location/Qualifiers
FT   CDS_pept        319154..319831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5673"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: bay:RBAM_031180
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5673"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46636"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR5"
FT                   /protein_id="ABY46636.1"
FT                   /translation="MNVLVFAAHPDDEIIGVGGTIAKHVEQGDDVHVVILAEGKSSRSK
FT                   EYRELDLEVKSLSYKETEGACTTLGVTSFARLDFPDNRLDTLPLLDVVKEIEEHINKIN
FT                   PTIIYTQYGGDINIDHTVVYRAVMTATRPLPNSNIKWVFAYETLSSTEWNYNEKDKFLP
FT                   NYFVNIEEHLETKLNAMKHYESELREFPHPRSIEAMKHNAFVWGAKSGYKAAEAFMLVR
FT                   GTW"
     atgaatgtac ttgtatttgc tgcgcacccg gatgatgaaa ttattggtgt tggtggaaca        60
     atagcaaaac acgtggaaca aggtgatgat gtacatgttg taatccttgc agaggggaaa       120
     tcttcgagat ctaaagaata cagagaacta gatttagagg ttaagagcct gtcttataaa       180
     gaaacggagg gggcatgtac tacacttggt gtaacaagtt ttgcgaggtt agattttcct       240
     gataatcgtc ttgatacatt gccattacta gatgttgtaa aagaaattga agagcacatt       300
     aataaaataa accctacgat tatttatact caatacggtg gagatataaa tatcgatcat       360
     actgttgttt atagagcagt gatgacagct acacgacctc taccaaatag taatattaaa       420
     tgggtgtttg catatgaaac cttatcttct actgagtgga attataatga gaaagataag       480
     tttcttccca attatttcgt aaatattgaa gaacatttgg agacaaaatt aaatgcgatg       540
     aaacattatg aatcggagtt aagggaattt cctcacccac gttcaataga agcaatgaag       600
     cacaatgctt ttgtatgggg agcaaagtca ggatataaag cggctgaagc atttatgtta       660
     gtaagaggaa catggtag                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page