(data stored in ACNUC9435 zone)

EMBL: CP000904.PE213

CP000904.PE213       Location/Qualifiers
FT   CDS_pept        319843..320778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5674"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bay:RBAM_031170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5674"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46637"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR6"
FT                   /protein_id="ABY46637.1"
FT                   /translation="MLIPQVPFFGLDSKQIDLKWVEQGYGLEANIFDGESLHDKSYTTK
FT                   FSDVLSFVQTLNPSLLTLHFPTDNADYLNSEFIKKQLYEFINLAIKYNAAGITVHANQF
FT                   MNIAEFQTYNLIDNRKRIIEFFKMIDEEIKGTNIWIGVENLPIIGNLGDDFDPIFVYPE
FT                   DFNDLVNLDLSNVGITWDICHWSITYLTRLGISKLLRQEEIEYKDFHKYINLMNHIKHL
FT                   HFSSFKHLTIPYSEVRCFEGESPTNGSINEHLLHETLLKVKNQVSSRNIGIVFEVQETD
FT                   YTNRVKSWETLNWFQKNITGIQANSNFLKI"
     atgttaatac cgcaggtacc attctttgga ttagatagca aacaaattga tttaaaatgg        60
     gttgaacaag gttatggatt agaagcaaat atttttgatg gagaatcttt acatgataag       120
     tcatatacaa caaagttttc agatgtactt tcttttgttc aaacacttaa tccatcttta       180
     ttaaccttgc attttccaac tgataatgca gactatttaa atagtgaatt tataaaaaaa       240
     cagttatatg agtttattaa tcttgctata aaatataacg cagcaggtat aacagttcat       300
     gctaatcaat ttatgaacat agcagaattt caaacttata atcttattga taatagaaaa       360
     agaattatag agttctttaa aatgatagat gaggaaataa aaggaaccaa tatatggata       420
     ggtgttgaaa acttacccat cattggaaac ttaggtgatg actttgatcc tatatttgta       480
     tacccagaag attttaatga cttggtaaat ttagatttat ctaatgttgg aataacgtgg       540
     gatatatgcc attggtctat cacttatctt acacgtctag gtatttctaa attattaaga       600
     caagaggaaa ttgagtataa agactttcat aagtatataa atttaatgaa tcatatcaaa       660
     catttacatt ttagttcttt taaacatttg acgattcctt atagtgaggt acgctgcttt       720
     gagggagaaa gtccgactaa tggttctatt aatgaacatt tattacatga aactttatta       780
     aaagtaaaga atcaagtttc aagtagaaat ataggaattg tattcgaagt acaggagact       840
     gattatacaa atagagtgaa atcatgggag actcttaatt ggttccaaaa gaatattact       900
     ggcatacaag caaactcgaa ttttttaaag atataa                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page