(data stored in ACNUC9435 zone)

EMBL: CP000904.PE215

CP000904.PE215       Location/Qualifiers
FT   CDS_pept        322392..323666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5676"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   btk:BT9727_0216 permease; probable multidrug resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5676"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46639"
FT                   /db_xref="GOA:A9VUR8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR8"
FT                   /protein_id="ABY46639.1"
FT                   /translation="MRSTWKEFKGMDLNVWIRFIGEALNGIAMMMLMPFFALYLKDKVD
FT                   SLLEVGVIIALSPIAASIGSLIGGHIADTYGRKPTMVLSMASNGLLMLFFLFIDGFIAY
FT                   AILSIGLGLCNSFFEPAASAMVTDVTEPEKRTEAYGLLRMAHNIGAAIGPIIGAAVVVV
FT                   SKDVIFLITSGTMLFYTILMVLFLKETKPKNVMIHEETPENSIRSTLRVVIRDRILLFY
FT                   IVTGIIIFMGFSQSEGMLPLHFSNEKTMIFGNSNPFPYLMTLNGLLVVFFQFPISKWLT
FT                   HKSIGKSMLYGAILFGIGLLAIGWLPKWFQVINTNDLVILVSLLIAYTVYTLGEMIMSP
FT                   VQMTFVANLAPEHLRGTYMGAANLQWITGNILGPLLGGLLLEHLLGHILFTILGVGCVM
FT                   SGFVYLLLDKLVEDRSKQIPIKQTS"
     atgagaagta catggaaaga gttcaagggg atggacctta atgtatggat tcgctttatt        60
     ggagaagctt taaatggtat tgcaatgatg atgttaatgc catttttcgc attatattta       120
     aaggataaag tggattcttt gcttgaggta ggtgtgatta tagctttatc tccaattgca       180
     gcaagtatag gctcgttaat tggaggacat atagcagata cttatggccg gaaaccaact       240
     atggtactct ctatggctag taatgggtta ttaatgctgt tttttttgtt catagatggt       300
     tttatagcat atgcaatctt atctatcggt ttagggttat gtaactcttt ttttgaacca       360
     gccgcatctg caatggttac ggatgtaaca gaaccagaaa aaagaactga ggcatatgga       420
     ttacttagaa tggctcataa tataggagca gcgataggtc ctataattgg cgcagcagtt       480
     gtagttgtat caaaagatgt catctttttg attacttctg gaaccatgct gttttataca       540
     atattaatgg tactgttttt aaaggaaaca aaacctaaaa atgtcatgat acatgaagaa       600
     acacctgaaa attcaataag atccacatta agagttgtta taagggatag gatattactt       660
     ttctatatag ttacaggaat cattatattt atgggattct cgcaatcgga aggtatgtta       720
     ccgcttcatt ttagtaatga gaagacaatg atttttggaa atagtaatcc atttccatat       780
     ttaatgacgt taaatggcct attagttgtt ttttttcaat ttcccatttc aaaatggtta       840
     actcacaaat cgattgggaa atcaatgcta tatggcgcaa ttctttttgg tattggtctt       900
     ttggcaatag gatggttacc aaagtggttt caagtaataa acacaaacga tttagttatt       960
     ttagtttcat tattaatagc ttatacagtt tatactttag gagaaatgat tatgtcacct      1020
     gtccaaatga ctttcgttgc taatttagct ccagaacatt tgaggggtac ttatatggga      1080
     gccgctaatc tgcagtggat tacaggtaat atattagggc ctcttttagg cggtttgtta      1140
     ctggagcatc ttctagggca tatattattt acaatcttag gtgtgggatg tgttatgtct      1200
     ggatttgttt acttattatt agataaactt gttgaggata gaagcaaaca gatacctata      1260
     aaacaaacat cttaa                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page