(data stored in ACNUC9435 zone)

EMBL: CP000904.PE216

CP000904.PE216       Location/Qualifiers
FT   CDS_pept        complement(323848..324315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5677"
FT                   /product="Transcription factor RsfA"
FT                   /note="TIGRFAM: Transcription factor RsfA; KEGG:
FT                   bca:BCE_3968 DNA-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5677"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46640"
FT                   /db_xref="InterPro:IPR014243"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR9"
FT                   /protein_id="ABY46640.1"
FT                   /translation="MVISRQDSWTNDNDSLLATIVLQNIRDGGTQLAAFKAVAKQLART
FT                   PAACGFRWNSYVRKQYEEEIQQAKQNRKSGNNKSPIQQTKETKSLSMTLDVIIIFLQNY
FT                   KEVNEVNNLQQQIEYLTAENKSLLQRLTTYEEEYRMLLNHIDKARNLIVVK"
     atggtaattt caagacaaga ttcctggact aacgataacg attcacttct cgcaacaata        60
     gtacttcaaa atattcgtga cggtggaaca cagttagctg catttaaagc agttgctaaa       120
     caattggcta ggacacctgc agcttgcgga tttcgttgga actcatacgt acgaaaacaa       180
     tacgaagaag aaatacaaca ggcgaaacaa aatcgaaaat ctggaaacaa caagtccccc       240
     atccaacaaa caaaagaaac aaaatcttta tctatgacat tagatgtcat tattatcttt       300
     ctacaaaatt ataaagaagt gaatgaagtg aacaatttac aacagcaaat tgaatattta       360
     acagcagaga ataaatccct tctacaacgg ttaaccacat acgaagaaga gtatcgtatg       420
     ttacttaacc atatcgataa ggcaagaaac ttgattgtag tcaaataa                    468
//

If you have problems or comments...

PBIL Back to PBIL home page