(data stored in ACNUC9435 zone)

EMBL: CP000904.PE219

CP000904.PE219       Location/Qualifiers
FT   CDS_pept        327234..327647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5680"
FT                   /product="protein of unknown function DUF86"
FT                   /note="PFAM: protein of unknown function DUF86; KEGG:
FT                   bcz:pE33L466_0270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5680"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46643"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUS2"
FT                   /protein_id="ABY46643.1"
FT                   /translation="MKNEVILNKISTIERCIKRIQEVYGNNPDNLEDYTKQDSIILNIQ
FT                   RACEASIDLAMHIVAGKKLGLPQSSREAFDLLVDADLLSTELASKLKAMVGFRNIAVHD
FT                   YQSVNLDIVRQIIEKHLKDFKLFTKEVMGILDL"
     atgaagaatg aagttatttt gaataaaatt tctacaatag agcgttgtat aaaaagaatt        60
     caagaggtat atggaaataa ccctgataat ttagaggatt atacaaagca agattctata       120
     atattaaata ttcaaagagc atgcgaagca agtattgatt tagcaatgca tattgttgca       180
     gggaagaagt tgggactacc ccaatctagt agagaggcat ttgatttgtt ggttgatgca       240
     gatctactta gtacagaact ggcaagtaag ttaaaagcaa tggttgggtt tcgaaatatt       300
     gctgttcatg attatcaaag tgtaaactta gatattgttc gtcaaattat tgaaaaacat       360
     ctaaaagact ttaagctatt tacgaaagaa gttatgggaa ttctagactt ataa             414
//

If you have problems or comments...

PBIL Back to PBIL home page