(data stored in ACNUC9435 zone)

EMBL: CP000904.PE22

CP000904.PE22        Location/Qualifiers
FT   CDS_pept        43103..44284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5454"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:BCZK0934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5454"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46446"
FT                   /db_xref="GOA:A9VV14"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV14"
FT                   /protein_id="ABY46446.1"
FT                   /translation="MNINKSFKGIAIAGLSVSFILVGCTLNTYGLTQSEYRKVDKYYDA
FT                   DKMVSDLKKLHYSDEHIENQLRNALSRIEYEKGSKEDGSSSKESKSNVSDTEDEKKVTV
FT                   SEKDYPYRLTELHLEFQYHLKKLEKKTDELFTEEGVYISEIDSLISHISLDINRFEKIK
FT                   PPKNYEDYQFLIQEGVEEIRKHLIKVEDAVRQYDDRKYDGEYDKDKAKEIIQNGMIGID
FT                   DGVSKWETVFNGINEKYPDVEQKVKEENQKHAKEGHREDDLNDKVSGSDVDKYKADIVG
FT                   NTNKMDEVIRLIQDIGHSDIKDYESKKSEIQLSLDVAKTHVRDMKYLEAPKGLEVEQEK
FT                   IKQSMDNYWDALQLFSEALEEQNDSKLEQADNKAEQAMKLFKKATESIKSKTN"
     atgaatatta ataaatcatt taagggtatc gcaatagcag ggttaagtgt tagtttcata        60
     ctagtaggtt gtacattaaa tacatatgga cttacacagt cagaatatag aaaagtagat       120
     aagtattatg atgcagataa aatggtatct gacctaaaga aattgcacta tagtgatgaa       180
     cacattgaaa accaactaag aaacgcattg tctagaattg agtatgaaaa gggaagtaag       240
     gaagacggat caagtagtaa agaaagtaaa tcaaatgtat cagacacgga agatgaaaag       300
     aaggtaacgg tatctgaaaa agattaccct tatcgtttga ctgaactaca cttagaattc       360
     cagtatcatt taaaaaaact agaaaagaaa actgatgaat tatttacaga agagggtgtc       420
     tacataagtg agatagattc cttaattagt cacattagtt tggatataaa ccgttttgaa       480
     aaaatcaagc cacctaaaaa ttatgaagac taccaattct taatacaaga aggggtagaa       540
     gagattagaa aacacctaat aaaagtagaa gatgcagtta gacagtatga tgaccgtaag       600
     tatgatggtg aatatgataa ggataaagca aaagaaatca tacaaaacgg tatgattggg       660
     atagatgatg gtgtttctaa atgggagaca gtatttaatg gaatcaacga gaaataccct       720
     gatgtagagc aaaaggtaaa ggaagagaat cagaaacatg caaaagaggg tcatcgtgag       780
     gatgatttaa atgacaaagt aagtggttca gacgttgata aatacaaagc agacatcgta       840
     gggaatacaa ataagatgga tgaagttatc agattgatac aagatatagg gcattcagat       900
     ataaaggatt atgagtcaaa gaaaagtgaa atccaactga gtctggatgt ggcaaaaaca       960
     cacgtaagag atatgaaata ccttgaagca cctaaagggt tagaggttga acaagaaaag      1020
     ataaaacagt caatggataa ttactgggat gctttgcaat tattttcaga agcattagaa      1080
     gaacaaaatg atagtaagtt ggaacaggca gataacaaag cagaacaggc tatgaaacta      1140
     tttaaaaagg caactgagag tattaaaagt aaaacgaact aa                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page