(data stored in ACNUC9435 zone)

EMBL: CP000904.PE221

CP000904.PE221       Location/Qualifiers
FT   CDS_pept        complement(328398..328967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5683"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bca:BCE_1177
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5683"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46645"
FT                   /db_xref="GOA:A9VUS4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUS4"
FT                   /protein_id="ABY46645.1"
FT                   /translation="MIKLEKENKKMKIIQSATILFSTRGVRNTTVDEIAKKAKVGKGTI
FT                   YYYYTDKTEILCDCYMRHIQLIRSQLFDLYKEEKDVLLRIQKILHYISLEYHQDPFVST
FT                   LFQEYKEYHSPEITACFKKSEEEAIKMISNLLEKGYQQGALHKVPLPLTAFMLVRMIFN
FT                   YEQDYIKDDKSDKEFLQLLKHMLLKN"
     atgatcaaat tagaaaaaga aaataaaaaa atgaaaatca ttcaatctgc cacaatactg        60
     ttctctacgc gtggtgtccg taacacaacg gttgatgaaa ttgcaaagaa agctaaagtt       120
     ggtaaaggta ctatttatta ttactataca gataaaactg aaatattatg tgactgctat       180
     atgcgtcata ttcagcttat acgttcacaa ttatttgatt tatataaaga ggaaaaagat       240
     gttttacttc gaatacaaaa aatccttcat tatatcagcc tagaatatca ccaagatccg       300
     tttgtttcta cactctttca agaatataaa gagtaccatt cacctgaaat tacagcttgt       360
     tttaaaaagt ctgaagaaga agcaattaaa atgataagta atttgctcga aaaaggttat       420
     cagcaaggag ctttgcataa ggtaccatta ccacttacag cttttatgtt agtacgaatg       480
     atttttaact acgaacagga ttacataaaa gatgataaaa gtgataaaga atttctgcag       540
     ttgctaaaac atatgcttct taaaaactag                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page