(data stored in ACNUC9435 zone)

EMBL: CP000904.PE225

CP000904.PE225       Location/Qualifiers
FT   CDS_pept        332985..333596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5688"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:BCZK1840 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5688"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46649"
FT                   /db_xref="GOA:A9VUS8"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUS8"
FT                   /protein_id="ABY46649.1"
FT                   /translation="MVDIVNATRQTTSLIESNKSSPSLKFYICIDGNFYSSLDKLFWRN
FT                   FKMEKLKKWFSLSTHKDERIQQIEMKIWAQSGIVVLLLAFIDVIIRGAYLHRPFLEWIA
FT                   SLAIILCYMIFFFIKSILTGVYETDINNKEQLNEKLKEKMSNTFIFCFVAIGATTYKYY
FT                   FPEDFGGWLAAIAKFIILFVFLFGIQYLITVIAWKRSNKI"
     ttggtcgata ttgtaaacgc tacgcgacaa accactagtc ttattgaaag taataagtct        60
     agcccttctt taaaatttta tatttgtata gatggaaatt tttatagtag tttagataaa       120
     ttattttgga ggaactttaa aatggaaaaa ctaaaaaaat ggttttcact cagtacacac       180
     aaagatgaaa gaattcaaca aattgaaatg aaaatttggg ctcaatctgg aattgttgtc       240
     ctacttttag cttttataga tgttatcata aggggagcat atcttcatcg cccatttcta       300
     gaatggattg cttcattagc cattatatta tgttatatga tattcttttt tattaaatct       360
     attttgactg gtgtttatga aacagatatt aataataaag aacaattaaa tgaaaaatta       420
     aaagaaaaaa tgagtaatac ctttattttt tgttttgtcg caataggtgc tactacatac       480
     aaatattact tccctgaaga tttcggtgga tggttagcag caatagcaaa attcattata       540
     cttttcgttt ttctatttgg tattcaatat cttattacag taatagcgtg gaagagatcc       600
     aataaaattt aa                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page