(data stored in ACNUC9435 zone)

EMBL: CP000904.PE226

CP000904.PE226       Location/Qualifiers
FT   CDS_pept        334029..334256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5689"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0351 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5689"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46650"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUS3"
FT                   /protein_id="ABY46650.1"
FT                   /translation="MDALLVRLIFYAGTEWLGFRTLFSSCNLIYQVIKELHIASLSKVF
FT                   GYAKPKFISHLPLGYALHTLEEGEFFRGIS"
     ttggacgctc ttttggtacg gttgatattt tacgcaggaa ccgaatggct tggttttcgc        60
     actctatttt cttcctgcaa cctcatatat caagttatca aagaacttca tatagctagt       120
     ttatcaaaag tttttggcta tgccaaaccg aaattcatct cccacttacc gttgggctac       180
     gcccttcaca cgcttgagga aggagaattc tttcggggaa ttagttaa                    228
//

If you have problems or comments...

PBIL Back to PBIL home page