(data stored in ACNUC9435 zone)

EMBL: CP000904.PE227

CP000904.PE227       Location/Qualifiers
FT   CDS_pept        335269..335535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5691"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5691"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46651"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT0"
FT                   /protein_id="ABY46651.1"
FT                   /translation="MFKKLVVGALATGVMLSGATGASAAVDTGNNLNNSNNSIAATCDY
FT                   KTFPYNSKDDMPMVVIKGGIKHYLKGTVINGGQLYGLYEPEYC"
     atgtttaaga aattagtagt aggggcttta gcaactgggg ttatgctgtc tggtgctaca        60
     ggagcatccg cagctgtaga cactggtaat aatttaaata acagtaataa ttcaattgcc       120
     gcaacatgtg attataagac ttttccttat aatagtaaag atgatatgcc tatggtagtg       180
     attaaagggg ggataaagca ttatttaaaa ggaactgtta taaacggtgg acagttatac       240
     gggttatatg aacctgaata ttgttaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page