(data stored in ACNUC9435 zone)

EMBL: CP000904.PE228

CP000904.PE228       Location/Qualifiers
FT   CDS_pept        336251..337777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5692"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1825 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5692"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46652"
FT                   /db_xref="GOA:A9VUT1"
FT                   /db_xref="InterPro:IPR013698"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT1"
FT                   /protein_id="ABY46652.1"
FT                   /translation="MDNQLPYQQPKREKALVIGAGIAGLLTARVLSSYFETVIVVEKDE
FT                   LPQKPSERPGTPQDFHPHRVLPRGEIIMNRFFPGYVDNLLNLGAHNVKNDKMIRFSPYG
FT                   ALELVIERKGAASSRALLEWTIRQRVQEISNVHFLSKQVVTGLLTSSDHKRVIGINIQE
FT                   RDELKTKRTVLTDLVVDTCGRQSKLNKWLTSMGYDVPEPERLKVNFGYSTRYYKVPPHI
FT                   KEKLSAISEGDPAKNVGAVGLLYIEDNIAQALLFVAGGTHYPPTNSKEYEKELDSLVTP
FT                   MMRELIKELDPISDPRGFRAHESTRQHFEQMENWPSGLLVLGDAFCNFDPIYGQGMTVA
FT                   AIEAEMLDTCLKEHSTHKPGFERKVLQRMQQAIEPAWWLSSIADLRWEGVEHVGAVPLK
FT                   GVKFTQKYFDLYLKQALKQARDGNSTMLQKYIMMNGLVYSPHEIINSDMLSMLITEDET
FT                   LEGNELLNELGEVDKRSLQERIHELIPSFTLAFENSIPNLFSSISISNAK"
     atggataatc aattaccata tcaacagcca aaaagagaaa aggcactcgt gattggagcc        60
     ggtattgcag gtttacttac tgcacgcgta ctttccagtt attttgagac agtgatagtt       120
     gttgaaaaag atgagttacc tcaaaaacca tctgaacgtc caggtacacc ccaagacttt       180
     catcctcatc gtgtattacc acgcggagaa ataattatga accgtttctt tcctggatat       240
     gttgataatt tattaaatct aggggcccat aatgtcaaga atgataaaat gattcgattt       300
     tctccttatg gggcacttga actagttata gaacgaaaag gtgcagcgag cagtcgagca       360
     ttgttagaat ggacaatccg ccaacgtgta caagaaattt ctaatgtaca ttttctttca       420
     aagcaagtgg tgacaggact tctaacttcg tctgatcaca agcgtgttat tgggatcaat       480
     attcaagaac gagatgaatt aaaaacaaag agaactgttt taactgattt ggtagttgat       540
     acatgtggcc gtcaatctaa actcaataaa tggcttacat ctatgggata tgatgttcca       600
     gaaccagaac gtttaaaggt gaattttgga tatagcacga gatattataa agtacctcca       660
     catatcaaag agaaattgag tgcaatttct gaaggagatc ctgctaaaaa cgttggagct       720
     gtagggctat tatatattga agataacata gctcaagcgc tactatttgt tgctggaggt       780
     acgcactatc cgccaaccaa ttcaaaagaa tatgaaaaag aactggattc attagttacc       840
     cctatgatga gggagttaat caaagagtta gatccaatta gtgacccaag aggatttaga       900
     gcgcatgaat caactcgtca acattttgaa caaatggaaa attggccatc tggattatta       960
     gtgttaggtg atgctttttg taactttgat cccatttatg gacaagggat gaccgtagcc      1020
     gccattgaag ctgaaatgtt agatacttgt ttaaaagaac attctactca taaacccgga      1080
     ttcgaacgca aagtgctgca acgtatgcaa caggctattg agccggcatg gtggctgagt      1140
     tcaattgcgg atttacgttg ggaaggtgtt gaacatgtag gagcagttcc actaaaaggt      1200
     gtgaaattta cacagaaata ttttgattta tatcttaaac aagctttaaa gcaagcaagg      1260
     gatggtaatt ctaccatgct ccaaaaatat ataatgatga atgggctagt ttattcgcct      1320
     catgaaatca ttaactcaga tatgttaagc atgttaatca ctgaggatga gactttggaa      1380
     gggaatgaac ttttgaacga acttggagaa gtagataaga gatcactgca agaaagaata      1440
     catgaactaa tcccttcctt tacattagct tttgagaata gcattccaaa tctattctct      1500
     tccatttcaa tttctaatgc caaatga                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page