(data stored in ACNUC9435 zone)

EMBL: CP000904.PE229

CP000904.PE229       Location/Qualifiers
FT   CDS_pept        complement(338075..338347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5693"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: bcy:Bcer98_1763 histone family protein DNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5693"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46653"
FT                   /db_xref="GOA:A9VUT2"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT2"
FT                   /protein_id="ABY46653.1"
FT                   /translation="MNKTELTKVVAEKAELTQKDAAAATQALLDTITNALANGDKVQTL
FT                   GFGTFEVRERSARTGRNPQTGEEMQIAASKAPAFKAGKELKEAVK"
     atgaataaaa cagaattaac aaaagtagta gcagaaaaag ctgaacttac acaaaaagat        60
     gctgctgcag caacacaagc gttattagat acaatcacaa atgcgttagc aaatggagat       120
     aaagtacaga ctcttggttt tggtacattt gaagtacgtg aaagatctgc acgtacagga       180
     cgtaacccac aaacaggtga agaaatgcaa atcgcggctt caaaagcacc tgcttttaaa       240
     gctggaaaag aattaaaaga ggcagtgaaa taa                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page