(data stored in ACNUC9435 zone)

EMBL: CP000904.PE23

CP000904.PE23        Location/Qualifiers
FT   CDS_pept        45389..46816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5456"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   bca:BCE_2758 permease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5456"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46447"
FT                   /db_xref="GOA:A9VV15"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV15"
FT                   /protein_id="ABY46447.1"
FT                   /translation="MNFIKRAILSMKKRIGTSLILMAVFLIVTNLVLAGFTIQNASKKA
FT                   ADAARKKLGADVTLGLDFDKLGKQARETGEAPNPPQLNTKETDQLAKSKHVKDYNYITH
FT                   NFGIADGFKLVGVSEGEGKGNGNARVATAGGSGSGTEIDMNSSLMIEGVRKTLLQESFK
FT                   NGKNKIVDGKPITEQMQDQNVALMEKRLAEQNNLKVGDKVKVQSGDKKETLEIEIIGIY
FT                   ETNEQPMGQNPPPMINPANKLYMPYSTLKKLEVDEGMSSIQVVYLLNDPQYIDAFKKEA
FT                   KKSDIDFNYFKLDAHDSLYKQMIGPIENIASTSQMIIYMVSIAGAIILGLIIMLSIKAR
FT                   RKEMGILLSIGEKKWKLMAQFVVEVVCIAILAFGLSITTGAKVSQFVGDNLLSSEIATA
FT                   SEETDTSQNSTVMVAGPGGSLQDQKKEPIDKIDVSVTGEDVGKMGGIGLAIAILATLLP
FT                   ALSILRLNPKQILLKDE"
     atgaatttta taaaacgcgc aattctcagt atgaaaaaaa gaataggaac atcattaatt        60
     ttgatggcgg tctttctgat tgttacaaac ttagtgctgg caggattcac aatccaaaat       120
     gcatcaaaaa aagctgctga tgcagcaaga aaaaaactgg gtgctgatgt tactttaggt       180
     cttgatttcg ataaattagg aaaacaagca agggaaactg gagaagcgcc taatccgccg       240
     cagctcaata caaaagaaac agatcaatta gcgaagtcca agcatgtaaa agactataat       300
     tatataaccc ataatttcgg aattgcagat ggatttaaat tagtaggagt ttcagaagga       360
     gaaggaaaag gaaatggaaa tgctagagtg gcaacggcgg gaggatcagg ttcgggtaca       420
     gaaatagata tgaattcttc tcttatgata gaaggagttc gcaagacttt attacaagaa       480
     agctttaaaa atggaaaaaa taaaatcgtt gatggaaaac cgattacaga acagatgcaa       540
     gatcagaatg tagctttaat ggaaaaacga ttagcggaac aaaacaattt gaaagtagga       600
     gataaagtta aagttcaatc aggggataaa aaggaaactc ttgaaattga aattatcggt       660
     atttacgaaa cgaatgagca accaatgggt caaaatcccc ctcctatgat aaatccagct       720
     aataaactat atatgcctta ctctacttta aaaaaattag aagtagatga aggtatgagt       780
     agtattcaag ttgtgtactt attgaacgac ccacaataca ttgatgcatt taaaaaagaa       840
     gcaaaaaaat ctgatattga ttttaattat tttaagttag atgcacatga ttcattgtac       900
     aaacaaatga ttggtcctat cgaaaatatc gcttctactt ctcaaatgat tatctatatg       960
     gtatctattg caggtgcgat tatcttagga ttaatcatta tgttatcgat taaagcacgt      1020
     cgtaaggaaa tggggatttt attgtccatt ggagagaaaa aatggaaact gatggcgcag      1080
     ttcgtagtag aagtagtatg tattgctatt ttagcatttg gattatccat aacaacagga      1140
     gctaaagttt ctcaattcgt aggggataac ttactttcga gtgaaattgc tacagcaagt      1200
     gaagaaacag acacctcaca aaatagtact gtaatggtgg ctggacctgg tggtagtcta      1260
     caagaccaaa aaaaggagcc aattgataaa attgatgtaa gtgtaacggg agaggatgta      1320
     ggaaaaatgg ggggaattgg actagctatt gctatattag caacgcttct tccagcatta      1380
     tctattctac gcttaaatcc aaaacaaatc cttttaaaag atgaataa                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page